Cherry SNP DataBase

Gene information

Gene Pav_sc0003478.1_g060.1.mk
Chromosome name PAV_r1.0chr8
start 7561897
end 7571392
PAV_r1.0 name Pav_sc0003478.1
start 32580
end 42075
direction -
Annotation NR PREDICTED: fatty acid amide hydrolase
Sequence CDS ATGGCGAAGAAGCGTGTGATGGTGGCTGCCCAGAACATCGACTTGTCCGCCGTCAAATAC GAGCAAGAAGAAATCAAAGCTCCCCATTTGACTGGCTTGGCTTTGAAGCTGTTTGTGTGG ATTGTTGAAGCACCGATCATAGGTTCTTTGGTAATCTCATTATTGAAGAAGCAGAACAAG ATGACTCAGTTGTTGCGGAATACTGTGATACCAGAGGCACCCATGTTCAAACCTGAATAT CCTCCCCAAGAACCAGAACCTGGTGTTGTTCCCCTTGATGAAGATGGAAAACCAGAAGAC AGAGTTGAAGTGGCCTTGAAATGCCTTCCACAATATGATCCTGCTAGCTGCTGGAATGGG GATTCAACTCCATCTTTCCGGTACTGGAAGATACGCGATTATGCTTATGCTTACCGTTCA AAGATTGCAACCCCATCTGTAGTAGCAGAGCATATAATTTCAGTTATCGGGGAATTCAGC AATAAGAAACCCCCACAACCTTTGTTGATTTCTTTCAACCCTGAAGAAGTCAGGAACCAA GCTGCAGCTTCAACAAAGAGGTTTGAGGAAGGGAATCAATTATCTATCTTAGATGGGATT TTTGTGGCAATCAAGGATGATATAGACTGCTTTCCCCATCCATCTAAGGGTGGAACAACA TGGATGCATGAGGTGCGCACTGTCAAGAAGGATGCAGTAAGTGTTTCGAGATTGCGTAGT TGTGGTGTGATTTTTGTTGGGAAGGCAAATATGCATGAGATTGGCATGGGTACAACCGGA AACAATTCAAACTATGGATCAGCGAGAAATCCCCATGCACCAGAAAGGTATACAGGTGGA TCTTCTTCAGGCCCTGCAGCAATTGTAGCTTCTGGGCTATGCTCTGCAGCCCTTGGAACT GACGGTGGAGGTTCAATCCGTATTCCTTCTTCGCTGTGTGGTGTGGTGGGCTTGAAGACA ACATATGGACGAACAAATATAGGAGGGTCATTATGTGATGCAGGGACTGTGGAAATTATT GGACCAATTGCATCTACAGTGGAGGATGTAATGCTAGTGTACTCGGCAATTTTGGGCACC TCTCTTGCAGATAGAATTAGTTTGAATCCGTCCCCACCTTCTGTGCCAAATTTTTCATTA TATGATAGTTTGAATAGTCTGGGATCCTTGCGACTGGGGAAGTATACAGCGTGGTTTAAT GATGTATATTCAACTGATATCTCTGATAAGTGTGAGGATGCTCTTAATCTTCTTTCAAAA ACTCATGGTTGTGAAATGGTAGAAATTGTTATACCCGAGCTCCATGAAATGAGTACTGCT CATCTTGTTTCAATTGGATCTGAGTGTCTCAGTTCGCTAAATCCGTATTGTGAGGATGGA CATGGTGCGAGATTGTCATATGATACACGTACAAGTATGGCCCTATTCCGATCATTTTCT GCGTCTGACTATGTTGCTGCCCAGTGTCTTCGGAGAAGGATTATGTACTATCATATGGAG ATCTTCAAGAAGGTTGATGTCATAGTTACCCCCACAACTGGCATGACAGCACCCATAATT CCATTGAGTGCTCTTAAAGATGGGGAGACAGACATGCGGGTTACAGGTATGCTTTTCTAC AGTCTGACTTCCTTCATTTCAGGTTATCTTATGCGGTTTGTCATTGCGGGAAATCTTCTC GGACTTCCTGCCATTTCTATACCTGTTGGCTATGATAAACAAGGACTTCCAATAGGTTTG CAACTGATTGGCCGCCCATGGGGTGAAGCATCAGTTTTGCGTTTGGCTTTGGCAATAGAG GAACTCTGTGCGAAGTCCAAGAAGAAGCCTGCATCATTCTTTGATGTCCTAAAATCTAAC TAA
PEP MAKKRVMVAAQNIDLSAVKYEQEEIKAPHLTGLALKLFVWIVEAPIIGSLVISLLKKQNK MTQLLRNTVIPEAPMFKPEYPPQEPEPGVVPLDEDGKPEDRVEVALKCLPQYDPASCWNG DSTPSFRYWKIRDYAYAYRSKIATPSVVAEHIISVIGEFSNKKPPQPLLISFNPEEVRNQ AAASTKRFEEGNQLSILDGIFVAIKDDIDCFPHPSKGGTTWMHEVRTVKKDAVSVSRLRS CGVIFVGKANMHEIGMGTTGNNSNYGSARNPHAPERYTGGSSSGPAAIVASGLCSAALGT DGGGSIRIPSSLCGVVGLKTTYGRTNIGGSLCDAGTVEIIGPIASTVEDVMLVYSAILGT SLADRISLNPSPPSVPNFSLYDSLNSLGSLRLGKYTAWFNDVYSTDISDKCEDALNLLSK THGCEMVEIVIPELHEMSTAHLVSIGSECLSSLNPYCEDGHGARLSYDTRTSMALFRSFS ASDYVAAQCLRRRIMYYHMEIFKKVDVIVTPTTGMTAPIIPLSALKDGETDMRVTGMLFY SLTSFISGYLMRFVIAGNLLGLPAISIPVGYDKQGLPIGLQLIGRPWGEASVLRLALAIE ELCAKSKKKPASFFDVLKSN


| Top |