Cherry SNP DataBase

Gene information

Gene Pav_sc0003565.1_g040.1.mk
Chromosome name PAV_r1.0chr3
start 7845920
end 7861445
PAV_r1.0 name Pav_sc0003565.1
start 16379
end 31904
direction -
Annotation NR PREDICTED: serine/threonine-protein kinase fray2
Sequence CDS ATGATGGAGAAGAAGAAGTATCCGATTGGACCAGAGCACTACACGCTGTATGAGGAGGTT GGGCAAGGCGTAAGCGCTTCCGTACATCGTGCGCTCTGTATACCCTTGGATGCGATCGTC GCCATCAAAATCCTCGATTTCGAACGCGACAATTGCGATCTGAACAACATTTCTCGTGAA GCTCAGACGATGATCCTGGTCGACCATCCTAATGTCCTCAAATCTCACTGTTCCTTTGTT AGTGATCATAATCTGTGGGTTGTCATGCCATTCATGTCTGGAGGTTCTTGTCTTCATATT TTGAAGGCAGCATACCCAGATGGTTTTGAGGAAGTTGTTATAGCCACCATATTACGTGAG ATTTTGAAAGGTTTAGAGTATCTTCACCATCATGGCCACATTCATCGAGATGTCAAAGCT GGGAATATTCTCATTGATTCACGCGGTGATAGGCAGCGCATGAGAAACACATTTGTGGGA ACACCTTGCTGGATGGCACCAGAGGTTATGGAGCAGTTACATGGTTATGATTTCAAGGCT GATATCTGGTCTTTTGGTATAACTGCATTGGAGCTTGCCCATGGCCATGCTCCTTTCTCA AAGTATCCTCCAATGAAGGTACTGCTCATGACCTTGCAAAATGCACCTCCTGGCCTTGAT TATGAAAGGGATAGGAAGTTTTCAAAGTCTTTTAAGCAGATGATTGCTAGTTGCTTGGTA AAGGATCCTTCAAAACGGCCTTCTGCAAAGAAGTTGTTGAAGCATTCCTTCTTCAAGCAA GCTCGGTCAAATGATTATATTGCACGAACACTTCTCGAGGGGCTGCCTGCTCTTGGTGAT CGCATCAAGGAATTAAAGATCCAGGATGCTGATGAACCTGTACCTGATAACATTCCGATG GGGACTTCCAATTCTCTGTCTGCTCTTGATGCACAACAAAAGCAATCACAATACAATGAT ATGATTCGGAACCAACAAGCTACTCTTCCACTCGTTGACACAACTTTATATGATGTCAAA GTTAGAAGTGACAAATCCGATGATGATTCTAGCATTGCTAGTTCTAGCCACGAACCACAT CTTTCACGAAATTCTTCACCTCGTCACGATGATCGTACTGAAAACAATTTGGGTGAAAAG CCTAATGTTGATAAACTGGAAGCTACGGCTATGCATAAAAGGCAATGCTCATCAGGCAGC AGTGGTTTATCAGAAGTTACTGATCCACTTATTAAAGGAGAGAGCGATAAATTTCCAAGT CAGCCCCAAAGTAATTTGAAATGCAACGCAGCAGTAGTTCCACAACTATCAGATGATACA CTTGCTGAGGTAATCTCTGCCTTCATAATTAATGAAGTTATTATTAATGCAGCAAATAAT GATGAACTTGATGAGAAAGCAAAGGTGCCTGTTGTACAGCAGAAAGGACGTTTCAAAGTC ACATCCGAGAATGTTGACTTAGAGAAGGTGGCCCCGGCTCCTATACTGCAAAAGAGTCAC AGCTTGCAGGTTCGTAGTTCTGAGGTGATTAGCATGAGTCCTGCAAGTCCTCTACCATCA GCTCTTCCATCACCCTTACCATCACCTCTAACATTACCTTCTGATGCTACCCCATCAGCT CTTTCTGGCTATTCTCTTTTCCCATTGTTAAACTCTGTTTTGCAGACAAATATTATTCAA AGGGAGAATATTTTAAGTTTAATGAAGCAAGTTGGTGCTAGTGATTTCGCAGCCAACCGT GCAGCTGACGGAGGATCCTCCCAGGCTACTAATGTGACAGAGAAACCAATGCCTCAAGCA GCTCTTGAGAGGGAAGCCGAGTTACTTAATGAAATTAATGAGTTGCAGAGGAGGCTCATG TCTGCCCAAGATGAGCTCCAAAAGTTAAAAGTAGATACTGCTTAA
PEP MMEKKKYPIGPEHYTLYEEVGQGVSASVHRALCIPLDAIVAIKILDFERDNCDLNNISRE AQTMILVDHPNVLKSHCSFVSDHNLWVVMPFMSGGSCLHILKAAYPDGFEEVVIATILRE ILKGLEYLHHHGHIHRDVKAGNILIDSRGDRQRMRNTFVGTPCWMAPEVMEQLHGYDFKA DIWSFGITALELAHGHAPFSKYPPMKVLLMTLQNAPPGLDYERDRKFSKSFKQMIASCLV KDPSKRPSAKKLLKHSFFKQARSNDYIARTLLEGLPALGDRIKELKIQDADEPVPDNIPM GTSNSLSALDAQQKQSQYNDMIRNQQATLPLVDTTLYDVKVRSDKSDDDSSIASSSHEPH LSRNSSPRHDDRTENNLGEKPNVDKLEATAMHKRQCSSGSSGLSEVTDPLIKGESDKFPS QPQSNLKCNAAVVPQLSDDTLAEVISAFIINEVIINAANNDELDEKAKVPVVQQKGRFKV TSENVDLEKVAPAPILQKSHSLQVRSSEVISMSPASPLPSALPSPLPSPLTLPSDATPSA LSGYSLFPLLNSVLQTNIIQRENILSLMKQVGASDFAANRAADGGSSQATNVTEKPMPQA ALEREAELLNEINELQRRLMSAQDELQKLKVDTA


| Top |