Cherry SNP DataBase

Gene information

Gene Pav_sc0003582.1_g090.1.mk
Chromosome name PAV_r1.0chr8
start 17079840
end 17084132
PAV_r1.0 name Pav_sc0003582.1
start 46859
end 51151
direction +
Annotation NR PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxisomal
Sequence CDS ATGGAGAAAGCGCATAACAGACAGCGTGTTCTGCTTCGGCATCTGTTGCCCAATTCTTCT TTTTCCTCTGCTCCTCCTGAAACCCATCAATCTGCTGCCCTGTCTGCTTCAATATGTGCT GCTGGGGATAGTGCTGCGTACCACAGAACAGCTGCTTTTGGAGACGATGCACTAATTGAG AGGACAAATTTGAACCCAAGTGAAGTAGGGGATATAGTTGTTGGTACGGTTTTGGCACCT GGCTCACTTAGAGCAATTGAGTGCAGGATGGCTGCATTTTATGCTGGTTTCCCTGATACG GTTCCCATCAGAACCGTCAACAGGCAATGTTCATCAGGCCTTCAGGCAGTTGCTGATGTA GCTGCTTCTATAAAAGCCGGATTCTATGAAATCGGTGTTGCAGCTGGATTGGAGTCCATG TCAGTTGATAAAATTGACACGATGAACAAAATTAACCCTAAAGTAGATATCTTTGCACAA GCCCGTGACTGCCTTCTTCCCATGGGTATTACCTCTGAAAATGTTGCACAGCGATATGGT GTGACACGGCAGGAGCAAGACAAAGCTGCTGTTGAATCACATAGCCGTGCTGCTGCAGCA ACAGCATCAGGCAAATTCCAAGATGAAATTGTCCCTGTATCTACTAAGATTGTGGATCCG AAAACTGGAGAGGAGAGGCCTGTTACAATTTCTGTGGATGATGGGATCCGGCCAAATGCA AACATGAATGATTTGGCAAAGATAAAGCCTGCATTTAAAGCAGATGGGTCTACAACTGCA GGAAATGCTAGCCAGGTGAGTGATGGTGCTGGAGCAGTTCTCCTCATGAAGAGAAGTTTA GCTATGCAGAAGGGGCTTCCTATTCTTGGTGTTTTCAGGAGTTTTGCTGCTGTTGGCGTT GACCCCGCTGTCATGGGAATAGGTCCAGCTGCTGCAATTCCAGTTGCGGTGAAATCTGCT GGTCTGGAGCTTGATGATATTGATCTATTTGAGATAAATGAGGCATTTGCATCTCAATAT GTATATTGTTGCAAGAAATTGGAGCTTGATCCTGAAAAAGTCAATGTCAATGGAGGTGCT ATTGCTCTAGGGCATCCTTTAGGCGCTACAGGCTCGGGTATGGGGGCTGCTGCAGTTTTT GAGAGAGGGGACTCAGTTGATGAGCTGTGCAACGTTAGAACAGTTGAAAGGAACAATCTT TTATCAAATAATGCTAGGTAG
PEP MEKAHNRQRVLLRHLLPNSSFSSAPPETHQSAALSASICAAGDSAAYHRTAAFGDDALIE RTNLNPSEVGDIVVGTVLAPGSLRAIECRMAAFYAGFPDTVPIRTVNRQCSSGLQAVADV AASIKAGFYEIGVAAGLESMSVDKIDTMNKINPKVDIFAQARDCLLPMGITSENVAQRYG VTRQEQDKAAVESHSRAAAATASGKFQDEIVPVSTKIVDPKTGEERPVTISVDDGIRPNA NMNDLAKIKPAFKADGSTTAGNASQVSDGAGAVLLMKRSLAMQKGLPILGVFRSFAAVGV DPAVMGIGPAAAIPVAVKSAGLELDDIDLFEINEAFASQYVYCCKKLELDPEKVNVNGGA IALGHPLGATGSGMGAAAVFERGDSVDELCNVRTVERNNLLSNNAR


| Top |