Cherry SNP DataBase

Gene information

Gene Pav_sc0003618.1_g060.1.mk
Chromosome name PAV_r1.0chr1
start 34425258
end 34432101
PAV_r1.0 name Pav_sc0003618.1
start 15496
end 22339
direction -
Annotation NR PREDICTED: cysteine-rich receptor-like protein kinase 28
Sequence CDS ATGGGACGTGAGCAACCTAAGGGCATAATGGTTTCCACTAAATTTCTATTATTTCTTCCC CTAATTTTGTTACCGATCATCGGTACTCAAGCCGTTGATATGTTCAACTGTCTTGACGCC TTTCCTAATACCACCATTCTCAATAGCACCTATCTCAAAAACGTCAATGGTGCTTTGTCC TCCCTCATCTCCTCCAACGATAGTAAGGGGTACGGGTTTTACAGTTCCTCCTACGGCGCT AACTCCGACAAAGTTTATGCAAATGGGCTTTGCAGAGGGGATTTGACGCCTGCTGCTTGC GTTACTTGCCTCAACAGCTCCAGGTATGCCCTCATGGAGAGTTGCCCTAATAATAGGGAG GCAAGTTTGTTGACCGAAGGCTGCAAGTTAGGATATTCAAACCACTCCATGCCAGGAAAC GTGGAATTGCTTCCATCTTTAACGTCCTATAGCAACAAAAATGTGTCATCGTCGTCGTCA GTCGTGGAAGGGTTTAATCAGCGGCTGGTGGCGTTATTGGGAGAACTAAAAGTGGAAGCG GCAGCCGGTGGTGACGTTCTTAAGTTTGCAGTGGGAAATGCAAGTGTTTCTATATATTCT AATAACATAAGTACAATATATGGACTTGCGCAGTGCAATCCAGATTTGTCTGAGCTGGGA TGTAATAATTGCTTAGGTGAAGCTCTTGGAAGGCTCCAAAAATACTGTTATGGGAATGGT TCTGGGAAATATGCTAATCCCAGCTGTGACTTAAGGTATGAGCTTAATTACCACTTCTTT GCCCCTGCAAATCAGACAATTTCAATTACTTCTTCCCCTAATTTTGTTACCGGGTTTAAC CAACGGCTGTTGGCGTTGCTGGGAGTACTAAAAGTTGAAGCAGCGGCTGGCGGTGATGTT AAGTTTACAGTGGGAAATGCAAGTGTTTCTATATATTCTAAGAATATAAGTACAATATAT GGACTTGCGCAGTGCAGCCCAGATTTGTCAGAGCTGGGATGTAACAATTGCTTAGATGAA GCTTTAGAAAAGATCCAAATGTATTGTTATGGGAATGGTTTTGGAAGCTATGTTAATCCC AGCTGTGACTTATATTATCAGGTTGATTACCTCTTCTTTGACCCTGCAGCTCAGACGGTA CCAGTGGCATTGCCACCATTAATATCTCCACCTACAGCCAATGCAAGAGGTGCTGCCAAT AGCACGGGAACAGCAAACACAGCTGGGCCTTCCCCGAGTTCAGCCCCTTCAACTCCCTCA ACGCACACTCCTGGAGATGTAATCTCAATGCCTGCCTTTCCCCCTGATGGTACTGGGACC CTTACATCACCATCAAATCAGTTGGTGAGCGACTTCTTCAACTTCTGGGATGATAAAGAT CTTGAATTGCAGGCTGATATGGATCGATTTGTAGAGGATGGGTTCACATTTACGGAAGTA CACACTGTTAAAGCAAGCACAAGCAAGGTTACTAGCTGTCACTTCTCATCGGATGGAAAG TTTCTTGCTAGTGGTGGCCATGATAAAAAGGCTGTATTGTGCTACACAGATACATTAAAG TTAAAATCAACCCTTGAAGAACATTCAGCTTTGATCACTGATGTTCGTTTTAGTCCAAGC ATGCCACGTCTTGCAACGTCTTCATTCGACGAAACTGTCAGGATTTCCACCCAAATAAAG ATAACCTTATCTGCTCCTGCGACTCGGATGGTCAGATACGCTACTGGAGTATTAACAATG GCAGCTGCTCAAATGAGATTTCAACCCCGCCATGGAAGATTTCTTGCTGCAGCAGCAGAT AATGTTGTATCTATACTGGATGTCGAGACACAGGCTTGTCGGCATTCATTACAGAAAAAA GGGGATCCTGCTTGA
PEP MGREQPKGIMVSTKFLLFLPLILLPIIGTQAVDMFNCLDAFPNTTILNSTYLKNVNGALS SLISSNDSKGYGFYSSSYGANSDKVYANGLCRGDLTPAACVTCLNSSRYALMESCPNNRE ASLLTEGCKLGYSNHSMPGNVELLPSLTSYSNKNVSSSSSVVEGFNQRLVALLGELKVEA AAGGDVLKFAVGNASVSIYSNNISTIYGLAQCNPDLSELGCNNCLGEALGRLQKYCYGNG SGKYANPSCDLRYELNYHFFAPANQTISITSSPNFVTGFNQRLLALLGVLKVEAAAGGDV KFTVGNASVSIYSKNISTIYGLAQCSPDLSELGCNNCLDEALEKIQMYCYGNGFGSYVNP SCDLYYQVDYLFFDPAAQTVPVALPPLISPPTANARGAANSTGTANTAGPSPSSAPSTPS THTPGDVISMPAFPPDGTGTLTSPSNQLVSDFFNFWDDKDLELQADMDRFVEDGFTFTEV HTVKASTSKVTSCHFSSDGKFLASGGHDKKAVLCYTDTLKLKSTLEEHSALITDVRFSPS MPRLATSSFDETVRISTQIKITLSAPATRMVRYATGVLTMAAAQMRFQPRHGRFLAAAAD NVVSILDVETQACRHSLQKKGDPA


| Top |