Cherry SNP DataBase

Gene information

Gene Pav_sc0003823.1_g040.1.mk
Chromosome name PAV_r1.0chr7
start 5202698
end 5206105
PAV_r1.0 name Pav_sc0003823.1
start 13083
end 16490
direction +
Annotation NR PREDICTED: leucine-rich repeat receptor-like tyrosine-protein kinase At2g41820
Sequence CDS ATGGCAGTTTTGTGCTTGTTATGCCTTCTTCTAGTTGGGTGCTTGTCTGAGTCTCAGCTT GTGGGTGCTCAGCTTCATGATCTAACTACATTGTCAGCCATTAACGAAGAACTTGGTGTA CCTGGTTGGGGTGCCAACTTTTCAGATTATTGTTCTTGGCCTGGCATTAGCTGCGGTTTG AACCATTCTATGGTGGAAAAGCTTGATCTTTCTCAGCTGGGTAATCTCAGAAACCTTAGA TCATTGAACCTGTCCAATAACTTGCTTGTGGGAGAAATACCAGATGAAATTCAGGCCCTA GAGAAGTTACAGGATTTTCAAATTTCTAGTAATAGGTTGAATGGCACTATCCCAAAGTGG GTGGGCAATTTGACCAATTTGAGGGTTTTTACTGCCTATGAGAATAAATTGGAGGGTAAA ATTCCAGATAATCTAGGCTCAATTTCTGAGCTTGAATCGTTGAATCTGCATTCTAACCAG CTAGAAGGTCCAATTCCCAAAAGTATTTTTGCTTCTGGGAAGCTGGAGTTTTTGGTTCTG ACCCAGAACAGACTGAGTGGAGACATTCCTGAAGAAATGGGAAACTGCAGTAGCCTATCT AGTATCCGAATCGGGAACAATGATCTTATAGGTAGCATTCCTCATTCAATTGGGAATATT AGTGGCCTCACCTACTTTGAAGCAGACAACAACAATCTTTCTGGTGAGATTGTTCCAGAA TTCTCCAAGTGCTCTAATCTCACCCTCCTAAATTTAGCCTCAAATGGATTTACTGGGAAG ATTCCTCCTGAGCTTGGACAGCTTATGAATCTGCAGGAGTTAATTCTCTCTGGTAACAGT CTTATCCCTCCTGAAATTGGTCGAATAAAAAACTTACAGATAGCCTTAAATTTAAGCTTC AATCATCTCAGGGGACCTCTTCCCCCTGATTTAGGTAAACTTGACAAGTTGGTTTCTCTT GATGTCTCCAATAATCAGCTCTCTGATATCATTCCAACTGCATTTAAGGGGATGTTAAGT TTAATAGAGGTCAATTTCTCCAACAATCTGTTCACTGGCCCAGTACCCACATTTGTACCA TTTCAGAAGAGTCCGAATTCCAGTTTTCTTGGAAATAAAGGGCTTTGTGGAGAGCCACTG AGCTCCTCATGTGGAAATTCTAACAGTGGTGGCCATGCAAATGACCATCACAGGGTTTCT TACAGGATCGTACTGGCCGTTATTGGTTCTGGTTTGGCAGTTTTTGTATCTGTAACCGTA GTGGTTCTGCTGTTCATGATCAGAGAGAGACAGGAGAAGGCAGAAAAATCTGCAGGGACT GAAGATGAGGAAGCCAATAATGTACCCGCGATAGTGGCAGGGAATGTCTTTGTTGAGAAT CTCAAACAAGCAATAGATCTTGATTATGCTGTTAAAGCAACTCTGAAGGATTCAAACAAG CTCAGTACTGGGACTTTTAGCACAGTTTACAAGGCTGTTATGCCATCTGGGCTGATTCTA TCAGTGAAGAGACTGAAATCCATGGACAGGACAATCATTCATCACCAGAACAAGATGATT AGAGAGCTTGAAAGGCTGAGCAAACTCTGTCATGATAACCTAGTGCGTCCTATCGGATTT GTTATTTACGAAGATGTTGCTCTTTTGCTGCATCATTACTTGCCCTATGGGACATTGTGT CAGCTTCTTCATGAATCTACCAAGCTACCTGAATATGAACCTGACTGGCCAACAAGACTT TCTATTGCCATCGGAGTTGCAGAAGGTTTGGCCTTTCTTCATCACGTGGCAATTATCCAC CTTGATATTTCTTCTGAATATGCATATACAATGCAAGTTACAGCACCCGGGAACGTCTAC AGCTATGGTGTTGTTTTGCTTGAGATCCTTACAACCAAATTACCAGTAGATGAGGCCTTC GACGAGGGGGTGGATTTGGTGAAGTGGGTGCATAATGCTCCATCAAGAGGTGAAACCCCA GAGCAGATTCTCGATGCAAGGCTTAGCACAGTTTCCTTTGGTTGGCGGAAAGAAATGCTC GCAGCACTGAAGATTGCACTACTCTGCACTGACAGCATACCGGCCAAACGACCCAAAATG AAGAAGGTTGTGGAAATGCTTCAAGAAATAAAACAGAACTGA
PEP MAVLCLLCLLLVGCLSESQLVGAQLHDLTTLSAINEELGVPGWGANFSDYCSWPGISCGL NHSMVEKLDLSQLGNLRNLRSLNLSNNLLVGEIPDEIQALEKLQDFQISSNRLNGTIPKW VGNLTNLRVFTAYENKLEGKIPDNLGSISELESLNLHSNQLEGPIPKSIFASGKLEFLVL TQNRLSGDIPEEMGNCSSLSSIRIGNNDLIGSIPHSIGNISGLTYFEADNNNLSGEIVPE FSKCSNLTLLNLASNGFTGKIPPELGQLMNLQELILSGNSLIPPEIGRIKNLQIALNLSF NHLRGPLPPDLGKLDKLVSLDVSNNQLSDIIPTAFKGMLSLIEVNFSNNLFTGPVPTFVP FQKSPNSSFLGNKGLCGEPLSSSCGNSNSGGHANDHHRVSYRIVLAVIGSGLAVFVSVTV VVLLFMIRERQEKAEKSAGTEDEEANNVPAIVAGNVFVENLKQAIDLDYAVKATLKDSNK LSTGTFSTVYKAVMPSGLILSVKRLKSMDRTIIHHQNKMIRELERLSKLCHDNLVRPIGF VIYEDVALLLHHYLPYGTLCQLLHESTKLPEYEPDWPTRLSIAIGVAEGLAFLHHVAIIH LDISSEYAYTMQVTAPGNVYSYGVVLLEILTTKLPVDEAFDEGVDLVKWVHNAPSRGETP EQILDARLSTVSFGWRKEMLAALKIALLCTDSIPAKRPKMKKVVEMLQEIKQN


| Top |