Cherry SNP DataBase

Gene information

Gene Pav_sc0003823.1_g260.1.mk
Chromosome name PAV_r1.0chr7
start 5300480
end 5307944
PAV_r1.0 name Pav_sc0003823.1
start 110865
end 118329
direction -
Annotation NR PREDICTED: translation factor GUF1 homolog, chloroplastic
Sequence CDS ATGGAGATGGCAACATGCAGCTTCCACAGCTCCTCCTTCACCCTCCCAAACCCTAACTTT AACCCTCGAACCAACCTTTCCTCTCCTCTTCCACTCTCCAAGCAACTCTTCGGTTTCAGC TTACCTTCTTCTTCAACCGCCAAAACCACCACACTCAAACTCCGTACCCGTAACCCAAAA CCCTTCTCCACTCACCCATCAATCAAATGCTCCGTTTCTGAAGCCACCGAAGCAGCCACC GCAGAAAGGAGGAGAAAGTTGATGAGGAGAAGTGACATAAGGAATATAGCAATTGTGGCG CATGTTGATCATGGAAAGACAACTTTGGTTGATGCAATGTTGAGGCAATCAAAGGTGTTT CGCGATAACCAATTTGTTCAGGAAAGGATAATGGACTCAAATGATATAGAGCGTGAAAGG GGAATTACTATACTAAGCAAAAATACATCTATTACGTATAAAGATTCAAAGATTAATATA ATTGATACTCCTGGCCATTCTGACTTTGGAGGCGAAGTCGAACGGATCCTCAATATGGTG GAAGGGATTCTTCTAGTGGTAGATTCTGTTGAGGGCCCAATGCCGCAGACAAGATTTGTT TTGAAGAAGGCTCTAGAATTTGGCCATGCTGTTGTTGTTGTTGTGAATAAGATTGATAGG CCTTCAGCTCGTCCAGATTTTGTCATCAATTCCACTTTTGAACTCTTTATTGAATTAAAT GCGACTGATGAACAGTGTGATTTCCAAGCAATATATGCGAGTGGGATTAAAGGAAAGGCA GGGTTGTCAGCGGATAATTTGGCAGATGATCTTGGGCCCCTTTTTGAGAGCATAATGAGA TGCATACCTGGACCTGCTATCGACAAAGATGGTTCACTGCAAATGCTTGCTACAAATATC GAGTATGATGAACACAAAGGGCGAATAGCTATTGGACGCTTGCATGCTGGGATTCTGAAG AAGGGGATGGATGTGAAGGTATGCACCTCAGAAGATTCATGTCGATTTGCAAGAGTTAGT GAGCTCTTTGTGTACGAGAAGTTCAGTAGGGTTCCTGCAGAAAGTGTGGAGGCTGGTGAT ATATGTGCTGTTTGTGGAATTAATGATATTCAGATTGGCGAGACAATTGCCGATAAGACC AATGGGACACCATTACCTGCAATTAAGGTGGAGGAACCAACTGTGAAAATGGCTTTCTCT ATCAACACTTCACCGTTTGTCGGACGCGAGGGAAAGTATGTTACAAGTAGGAACTTACGA GATCGTCTTTCTCGTGAGCTTGAGCGTAACTTGGCTATGAAGGTTGAAGATGGTGAAACA GCAGATACCTTCGTTGTTAGTGGACGGGGTACTTTACATATTACCATATTGATAGAGAAC ATGCGAAGAGAAGGGTATGAATTCATGGTGGGACCTCCCAAAGTTATTAACAAAAGGGTG AATGACAAGTTGTTGGAACCATATGAGATTGCCACTGTAGAGGTTCCAGAAGAACACATG GGCGCTGTCGTTGAGCTTCTTGGCAAAAGACGGGGGCAGATGTTTGATATGCAAGGGGTT GGGTCGGAAGGCACAACCTTCCTCAAATATAAAATTCCAACTCGTGGCCTTCTTGGTCTG CGAAATGCAATTTTAACAGCTTCTCGTGGCACTGCGATTCTCAACACAATATTTGATAGC TATGGACCTTGGGCTGGTGATATGAGTACCCGGGATCTGGGCTCACTGGTTGCCTTTGAG GGTGGAACGAGTACTTCTTATGCCATTTCTAGTTCACAGGAGAGGGGGCAGTTGTTTATT GGTCCTGGGGTGGAAGTTTATAAAGGTCAGATAGTTGGCATCCATCAGCGGCCTGGGGAC TTATCCCTTAATGTGTGTAAGAAGAAGGCTGCAACAAACATCCGTTCCAACAAAGATGTA ACAGTGATTCTTGATACCCCATTGGACTACAGTCTGGATGACTGCATTGAGTATATTCAA GAGGATGAACTGGTGGAGGTTACTCCTTCGAGTATCCGAATGTGCAAAAACCCAAAGTTC TCAAAGAAATCAAACAGGTAG
PEP MEMATCSFHSSSFTLPNPNFNPRTNLSSPLPLSKQLFGFSLPSSSTAKTTTLKLRTRNPK PFSTHPSIKCSVSEATEAATAERRRKLMRRSDIRNIAIVAHVDHGKTTLVDAMLRQSKVF RDNQFVQERIMDSNDIERERGITILSKNTSITYKDSKINIIDTPGHSDFGGEVERILNMV EGILLVVDSVEGPMPQTRFVLKKALEFGHAVVVVVNKIDRPSARPDFVINSTFELFIELN ATDEQCDFQAIYASGIKGKAGLSADNLADDLGPLFESIMRCIPGPAIDKDGSLQMLATNI EYDEHKGRIAIGRLHAGILKKGMDVKVCTSEDSCRFARVSELFVYEKFSRVPAESVEAGD ICAVCGINDIQIGETIADKTNGTPLPAIKVEEPTVKMAFSINTSPFVGREGKYVTSRNLR DRLSRELERNLAMKVEDGETADTFVVSGRGTLHITILIENMRREGYEFMVGPPKVINKRV NDKLLEPYEIATVEVPEEHMGAVVELLGKRRGQMFDMQGVGSEGTTFLKYKIPTRGLLGL RNAILTASRGTAILNTIFDSYGPWAGDMSTRDLGSLVAFEGGTSTSYAISSSQERGQLFI GPGVEVYKGQIVGIHQRPGDLSLNVCKKKAATNIRSNKDVTVILDTPLDYSLDDCIEYIQ EDELVEVTPSSIRMCKNPKFSKKSNR


| Top |