Cherry SNP DataBase

Gene information

Gene Pav_sc0003915.1_g070.1.mk
Chromosome name PAV_r1.0chr1
start 14417666
end 14422759
PAV_r1.0 name Pav_sc0003915.1
start 38257
end 43350
direction -
Annotation NR PREDICTED: uncharacterized protein LOC103322628
Sequence CDS ATGGAAGCAAAACACACTTCCATGAAATGGAAGCGACCTTCACCTTCAATGGACATCAGC ACCAGCAGCAAATCTCAGATCTATCACAACAATCGCTCCGGTCTGGTCAGAAATAGTAAC GGCCATCCCGAGCTTCTGAGCCACCAATCGAACCCGAAAAGGCCCAGATCAGTAGAGCCG ATAAGACAAGGCTCTCTGGATGGCAACATGCCCCTCCACTCTCTGATTAAGGATCTCCGC GTCAAAAGGGTCTTTTCCGCAACCTCTAAGCCCCCTGAGAATCTGACTGACCACCACAAA TTTGGCGCCGAATTCGGTTCGTATGAACAAGAAAATGGCCCCAAGTCGGTGAAGAATGGT GGGGTTGAGAGTTCTGGAAATGGGTTTTCTCGCTCAGGTCCAGATGTAGATGATTCGGAG AGCAAAGGGACTGAGAGATTGGATATGGGTTTTGTGTCTAAAGCCCGAAGAACAGATCAT TTGAGTCTTAAATCTCCGGTGAGAGAAGGGATTGGAGGCATATCATCCGATGTGGAGCAG AGGAGTGGTGATGCGAATCAGGATTGTTCTCAGAAATCATCGGCTGATGTGAAGGAAAAT GGTGTTCGTCTCAATTTTGAAAATAAAACCAAATTGGTCCTTAAGCCTCGACAGAGAGTG TTCAAAGCTCCTGGATCATTCGGTTATCGAAGATTGCTTCCGTATCTTAAGGATATTGCC GAAGATATTTCTTGTGCGCTTGATTTTTGTCAACACCCAAATCTTTATAAAGGATCAGAA GGAAAACCATTCCAGGGTATGCGGGCTTCGAAAAATCCACCGGGTTCCTTACATCAATTT GATGCCCACAAACTTTCCAGGGAGTATCATACCAGTGGTTCTTCTACTCTGCTAGAAAAT GTACAAGTTTGTTTCCAGGAAACATCTAATGGCAATGAGAGAAGTTCAGAATCTCCTGAA TGTGTTCCTGCGTCACCATCTATAACTGTGGTGGATGAGTGTCTGTCAAAGCCACCTGTC GATGGACAGACTGAAAAGTTTGATGTGGGATTTTCTTGTAAAGCTCAGAAGTTAAATGCC TCACCCCTTTCCTCTTCGGCTATGGAGGATTCTCAAGTTAACAAGGATCATGTAATTGAC ACGCATATTGATTTTTATACACCAGCTGAAGATGTGGGGACTTCTGATAAAGCTGGTAAT GGCGAAGCTCAAAATGTGGAAGATATGAATTCCTTGTCGTCATCTATGATGGATGAGTGC TACTCATGCAAGGTTAATGTCATAGGTCAGAACTGTGAGAACTCAAATCAAAATCATATA AACGAGCAGAGAGTTTACAATGCTGGTCTGGTTCTCAATCAGATAGATGACTCAAATGAA GAATCAGTCCAGAGGACACCACCAGATGCTGAAATGTTAGGTAAACTAGAGGTGGAAGTG AAAAGAATTAGTAGAGCGGGATATGTTCTTCAGACTGCAAATCTAAGTCTTGGGAAGCCA TCCAATGTATTTAATCATACAGATGCTACCTGCGTTGATGTTAAAAAACAGGAATCTACT CCGAAGAGAAAGCGGGTTTTGAATCCTTGTTCACGCCTGAAGTTATTTAGAAGTCCAGGT TCAGTCAGCTACAGAAGATTGCTTCCATATCTTTTGGATATCGAAAAAAATAATTCTTGT GCAAATACTAATAAGGATTTGGAGCATAGGCTACAGCCACCATTGACTCCTAATCAGCAA GAAACTCTAATGGATCAATCAAATGATTTCAGATTTCATTCCGAGCATCAGATTTGTGAT CCTGGTACTCTACCAACACCTCAATTAACCAGTGCTAATGGCTCATCCAATTACGGTGGA GATAATCTAACATCTCCTGAACACGTGGCTGAATCTCAAATGTCATTTGATGTACAAAAG GAACAACATGTTCAACAGGCTGCATCAGGTAATCAAAGTAAATTAGAAACTTCCCCTGAC ATTGTGAGTTTGGGACATGAAAAAGATCCAATCACTTTGTTCTTCCCAAGCACTTGTGAA GCTACTTCGATAAAAGATGGTGCAATATCAGTCACAAATTCATCATCTGATTGTCCTGAA GAGGACCACATAGGCTCAAGAATAGCATTGTCCAGTGGGGGAAAGCCATTGCCAGTTCAA GCCGACAGTTTGTGTCAGAACTCATCCCAAATTGATGCAACAGTTTCTTCTGGTATTCAT TCAGATGGACTCAGAAAACAGATCCTTAAAAGAAATCCACGAGGATGCAGAGGGCTCTGC ACTTGTTTGAATTGCACTTCGTTTCGACTCCATGCAGAGAGAGCATTTGAGTTCTCCAGA AATCAGATGCAAGATGCTGAAGAAGTAGCTTTAGATTTGATGAAGGAACTATCAAGTTTA CGTAAGATGTTTGAAATGTCAGCTGTTGGTGCAAATACTCACGTCGTGGATTTAAATGAG GTGAAAGAAGCTTGCAGGAAAGCATCTGAAGCAGAAGAGAATGCAAGAAACCGTCTTGAT GAAATGAATTATGATCTCAACATTCACTGCAGAATCACATGCGTGCATGGACCAAAGGTC ACATTTGCAAATTATGTAGAAGAAAAGTCATCCCAAAAGCAAACTTTTCAGGCAACTAGT CTCAAGCCATGA
PEP MEAKHTSMKWKRPSPSMDISTSSKSQIYHNNRSGLVRNSNGHPELLSHQSNPKRPRSVEP IRQGSLDGNMPLHSLIKDLRVKRVFSATSKPPENLTDHHKFGAEFGSYEQENGPKSVKNG GVESSGNGFSRSGPDVDDSESKGTERLDMGFVSKARRTDHLSLKSPVREGIGGISSDVEQ RSGDANQDCSQKSSADVKENGVRLNFENKTKLVLKPRQRVFKAPGSFGYRRLLPYLKDIA EDISCALDFCQHPNLYKGSEGKPFQGMRASKNPPGSLHQFDAHKLSREYHTSGSSTLLEN VQVCFQETSNGNERSSESPECVPASPSITVVDECLSKPPVDGQTEKFDVGFSCKAQKLNA SPLSSSAMEDSQVNKDHVIDTHIDFYTPAEDVGTSDKAGNGEAQNVEDMNSLSSSMMDEC YSCKVNVIGQNCENSNQNHINEQRVYNAGLVLNQIDDSNEESVQRTPPDAEMLGKLEVEV KRISRAGYVLQTANLSLGKPSNVFNHTDATCVDVKKQESTPKRKRVLNPCSRLKLFRSPG SVSYRRLLPYLLDIEKNNSCANTNKDLEHRLQPPLTPNQQETLMDQSNDFRFHSEHQICD PGTLPTPQLTSANGSSNYGGDNLTSPEHVAESQMSFDVQKEQHVQQAASGNQSKLETSPD IVSLGHEKDPITLFFPSTCEATSIKDGAISVTNSSSDCPEEDHIGSRIALSSGGKPLPVQ ADSLCQNSSQIDATVSSGIHSDGLRKQILKRNPRGCRGLCTCLNCTSFRLHAERAFEFSR NQMQDAEEVALDLMKELSSLRKMFEMSAVGANTHVVDLNEVKEACRKASEAEENARNRLD EMNYDLNIHCRITCVHGPKVTFANYVEEKSSQKQTFQATSLKP


| Top |