Cherry SNP DataBase

Gene information

Gene Pav_sc0004042.1_g020.1.mk
Chromosome name PAV_r1.0chr6
start 14892933
end 14894645
PAV_r1.0 name Pav_sc0004042.1
start 6481
end 8193
direction +
Annotation NR PREDICTED: 2-alkenal reductase (NADP(+)-dependent)-like
Sequence CDS ATGGCGAGTGGCGTGGAGGAAGTTAGGAACAAGCAGGTGATATTGAAGGACTATGTATCT GGCAATCCCAAAGAGTCAGACATGTACGTGACAACCAGTTCCATAAAGCTCAAGGTTCCT CAAGGCTTAAAAGCAGTGCTGCTCAAGAACCTCTACTTGTCATGTGACCCTTATTTGAGG ATCCGAATGGATAGAATTCAAGGCTCTAATGTCTTCACTTCCTTCACTCCTGAATTCAAG GAAGGTGACTTGGTTTGGGGAACAACAGGATGGGAAGAGTATAGTCTCATCACAGAACCA GAACACTTCTTTAAAATCCACCACACTGATGTGCCCCTGTCCTACTACACTGGCCTTCTT GGTCGATCTACTAAAGAACAAGCTAGGCCACAAGGCTTTAGCAATCTTCTGTCTCTAATC TACAATCGGATCCGTATAGAAGGCTTTGTTGTTTTCGATTATTTCCATCTGTATCCCAAT TTCTTGGACATGGTCTTACCATACATCAGAGAAGGAAAGATAGTATATCTGGATGACATA ACTCAAGGCCTTGAGAGTGCTCCAGCAGCCCTTGTGGGACTTTTTAGTGGCAGAAATGTT GGAAAACAAGTAGTTTTGGTTTCCCATGAGTGA
PEP MASGVEEVRNKQVILKDYVSGNPKESDMYVTTSSIKLKVPQGLKAVLLKNLYLSCDPYLR IRMDRIQGSNVFTSFTPEFKEGDLVWGTTGWEEYSLITEPEHFFKIHHTDVPLSYYTGLL GRSTKEQARPQGFSNLLSLIYNRIRIEGFVVFDYFHLYPNFLDMVLPYIREGKIVYLDDI TQGLESAPAALVGLFSGRNVGKQVVLVSHE


| Top |