Cherry SNP DataBase

Gene information

Gene Pav_sc0004218.1_g010.1.mk
Chromosome name PAV_r1.0chr1
start 34488489
end 34495774
PAV_r1.0 name Pav_sc0004218.1
start 5328
end 12613
direction +
Annotation NR PREDICTED: pleiotropic drug resistance protein 1-like
Sequence CDS ATGGAGAGTGGAGAGAGAAAGAGTGTTTTGGAGAGGCTGGTTAAAACTGCAGATGAAGAT AATGAGAAGTTCCTGTTGAAGCTTAAGGACCGGATTAATCGGGTTGGACTGGATATTCCA ACAATTGAAGTCCGGTTTGAGCATTTGAGTGTTGAAGCAGAAGCTTATGTGGGAGGCAGG GCCTTGCCTACAATATTCAACTTTTGTGTTAACATTTTAGAGGGGTTCCTGAATTTTGTT CACGTTCTTCCAAGTAGAAAGCAACCATTACCAATCCTTGATGATGTTAGTGGAATTATC AAACCAAGAAGGAGAGAAAAGGCTGCAAATATCATGCCAGATGCGGATCTAGATATCTAC ATGAAGGCAGCATCACTAGAAGGACAAGAGACCAACGTAGTTACAGATTATATACTCAAG ATTTTGGGACTTGAGGTTTGCGCTGACATCATGGTGGGGGATGAAATGGTACGAGGTATT TCTGGTGGGCAAAAGAAGCGAGTCACGACAGAGGATGTGCAGAAGTGGTGGTTATGGGGT TACTGGGTCTCACCAATGATGTACGGCCAGAACGCTATAGCTGTCAATGAATTTCTTGGA AAGAGTTGGAGCCATGTTCCTCCTAATTCAACAGAATCATTAGGAATTATGGTCTTGAAG TCTCGCGGGGTTTTCATTGAACCATACTGGTACTGGATTGGAGTAGGAGCTACAATTGGA TACATTTTTCTGTTCAATTTCTTCTTCACTTTGGCCTTACAATATCTTGATCCATTTGGG AAGCCTCAGGCAATCCTATCCAAAGAGGCCTTAGCTGAGAAAACTAGTGATAGAACTGGA GATTCCATTGAGCTATCATCACGGGGAAAGAACTCTTCTGACTCAAGGAATGAAAGTCGA AGAAGTGTATCATCCAGAACATTGTCGGCGAGAGTGGGCAGCATTACTGAAGCCAACGAA AACAGGAAGCGCGGAATGGTTCTTCCTTTTGAACCTCTTTGGATTACTTTTGATGAAATC ACATATGCTGTTGACATGCCTGAGGAAATGAAAACTCAAGGTGTAACTGAGGATCGGCTA CAGCTTCTGAAGGGTGTGACTGGTGCTTTTAGGCCAGGAGTCTTAACAGCTCTAATGGGC ATTAGTGGTGCTGGAAAGACTACTCTAATGGATGTCTTGGCAGGAAGGAAAACAGGTGGA TATATTGAGGGAAACATCACAATATCTGGGCATCCGAAAAAGCAAGAAACATTTGCTCGC ATATCGGGATATTGTGAGCAAACTGATATACACTCTCCTCATGTTACGGTTTACGAGTCT TTGGTTTATTCTGCATGGCTCCGGTTGCCTCCTGAGGTTGATTCCTCAACAAGAAAGATG TTTGTTGAGGAGGTCATGGAGCTTGTAGAACTGACCTCGATAAGGGAAGCGCTTGTTGGA TTGCCTGGAGTGAATGGTCTCTCAACTGAGCAGCGCAAAAGGCTAACGATTGCAGTAGAG CTTGTTGCAAATCCATCCATTATATTTATGGATGAGCCAACCTCTGGCCTCGATGCCAGG GCAGCGGCAATTGTAATGAGAACAGTGAGGAATACAGTGGACACTGGGAGAACTGTAGTA TGCACCATCCACCAGCCAAGCATCGACATCTTTGATGCTTTCGATGAGCTGTTTCTTTTG AAAAGGGGAGGTGAAGAAATATATGTGGGTCCTTTGGGCCGCCATTCTACCCATTTGATC AAGTACTTTGAGGAAATTGATGGAGTTCCTAAAATTAAAGATGGTTACAATCCCGCGACT TGGATGTTGGAGATTACTGCAGCAGCACAAGAAGCAGCTCTTGGTGTCAACTTCGCCGAA ATATACAAGAACTCAGAACTCTATGGGAGAAACAAAGCTCTGATAAAGGACCTTAGTACT CCTCCAGCAGGTTCAAAAGACTTGTTCTTCCCTACTCAATACTCTCAGTCTTTCTTCAGC CAGTGTATGGCCTGTCTATGGAAACAACATCTATCATACTGGCGAAACCCGCCATACAGT GCAGTGAGACTCTTGTTCACAACTTTCATAGCTTTAATGTTCGGGACGATATTCTGGGAT CTCGGCTCCAAAAGGAGAAGCCAACAAGACCTTTTCAATGCAATGGGTTCCATGTATGCT GCTGTTCTCTTCATTGGTGTACAAAATGCTTCATCAGTGCAGCCAGTTGTGGCTATTGAG AGGACAGTCTTTTACAGAGAAAGGGCAGCTGGAATGTACTCAGCATTGCCATATGCCTTT GGACAGGTTGTGATTGAGCTCCCGTACATTTTTGTTCAAACCATCATATACGGAGTTATA GTATACGCCATGATCGGATTTGATTGGACAGTGAGCAAATTTTTATGGTATCTCTTCTTC ATGTACTTCACTTTCCTATACTTCACATTCTACGGCATGATGACCGTAGCCGTCACTCCC AACCACAACATTGCTGCCATAGTCTCCTCTGCCTTCTATGCTATATGGAACCTTTTCTCA GGATTCATCATTCCAAGAACGAGGATGCCGATTTGGTGGAGATGGTACTACTGGGTTTGC CCGGTTTCGTACACACTGTATGGATTAGTTGCTTCACAGTTTGGAGACATTAAAGAAATA TTTGATTCAGGTGAAAGTGCTGGTAAAAGTGTGGAACACTTTGTAAAGGACTACTTTGGC TACAGACAGGACTTTCTGGGAGTAGTTGCAGCCGTCCATGTCGGGATTTGCGTGCTCTTC GGCTTCACCTTTGCCTTCTCAATCAAGGTGTTCAACTTCCAAAAGAGATAA
PEP MESGERKSVLERLVKTADEDNEKFLLKLKDRINRVGLDIPTIEVRFEHLSVEAEAYVGGR ALPTIFNFCVNILEGFLNFVHVLPSRKQPLPILDDVSGIIKPRRREKAANIMPDADLDIY MKAASLEGQETNVVTDYILKILGLEVCADIMVGDEMVRGISGGQKKRVTTEDVQKWWLWG YWVSPMMYGQNAIAVNEFLGKSWSHVPPNSTESLGIMVLKSRGVFIEPYWYWIGVGATIG YIFLFNFFFTLALQYLDPFGKPQAILSKEALAEKTSDRTGDSIELSSRGKNSSDSRNESR RSVSSRTLSARVGSITEANENRKRGMVLPFEPLWITFDEITYAVDMPEEMKTQGVTEDRL QLLKGVTGAFRPGVLTALMGISGAGKTTLMDVLAGRKTGGYIEGNITISGHPKKQETFAR ISGYCEQTDIHSPHVTVYESLVYSAWLRLPPEVDSSTRKMFVEEVMELVELTSIREALVG LPGVNGLSTEQRKRLTIAVELVANPSIIFMDEPTSGLDARAAAIVMRTVRNTVDTGRTVV CTIHQPSIDIFDAFDELFLLKRGGEEIYVGPLGRHSTHLIKYFEEIDGVPKIKDGYNPAT WMLEITAAAQEAALGVNFAEIYKNSELYGRNKALIKDLSTPPAGSKDLFFPTQYSQSFFS QCMACLWKQHLSYWRNPPYSAVRLLFTTFIALMFGTIFWDLGSKRRSQQDLFNAMGSMYA AVLFIGVQNASSVQPVVAIERTVFYRERAAGMYSALPYAFGQVVIELPYIFVQTIIYGVI VYAMIGFDWTVSKFLWYLFFMYFTFLYFTFYGMMTVAVTPNHNIAAIVSSAFYAIWNLFS GFIIPRTRMPIWWRWYYWVCPVSYTLYGLVASQFGDIKEIFDSGESAGKSVEHFVKDYFG YRQDFLGVVAAVHVGICVLFGFTFAFSIKVFNFQKR


| Top |