Cherry SNP DataBase

Gene information

Gene Pav_sc0004229.1_g030.1.br
Chromosome name PAV_r1.0chr8
start 2372102
end 2374686
PAV_r1.0 name Pav_sc0004229.1
start 20756
end 23340
direction +
Annotation NR PREDICTED: putative ribonuclease H protein At1g65750
Sequence CDS ATGGCAGAAGGGCTAGTTTGGTTGGGTTCAGACCAATTGGATTGGGAAGGTGTAGTTGGA AGAGAGGTAGACAGACGCGTGCCTACCGACTTCCTGACCATAGGTATAGTGAAGCATGGA GGGTTGTTAGAAGATAAGAATGTTGAAATTGACTTGGTGAGGCAAGTGTTGTCACAAGAG GCTCGTGAATACCCAAATCTTGTGACACTTGGGAATTTGTTAAATTCAAGGCTTCTACAA AGAATGGCTGGAATTATCAAGGGATTTACAAAGGTGGTGCCTTCGCCAAAAGTTGTCCAA ATCGTCAAGGTGGAGAAGCAAAGACGTCTGAAGGAAAGGAGGCCGAAGGATAAGGGCACA CGATCAAAGAGGGTAAGGAAGGGGGCGAAAGACCTGCTGAAGATGCAACGGGAGGAAAAC GGTCACGTGACGATGGTGATGGTCTGGGACCTAGTTTACCAGTATGCACTGGATTGGTAC AATGCTTGTAAAACAATTGTAGGCACTCCAGAGCACACTGTGGTTAAGCTCCAATGGAAA ACTCCCAGACCTAGTGCATGTAAAGTTAACACAGATGGAAGTAGAATCAATGCCATTGGT CTTAGTGGTGCTGGAGGTTTATTACGAGATGCTACTGGTGCTTGGATCCAGGGCTTTATT GTGAATCTAGGTTCAAGTACAATCCTTGAGGCGAAATTATGGGGTATCTTTTGGGGGTTT AGTTTGGCTTGGGACCCTGGCTATCGTGATGTGGAGATTGAATGCGACTTTAATACTGCT GTCACTCTTTTATCTTCTCATATCGTTCCAACTAATCCTTTGTACAACATCATTTCTTGC TGTAAAATAAAGATCCATGAACCCTGGTGTTGTGCAATTAAGCATATCTACCGTGAACAA AATGTAGCCACTATTGCTTTGGCTACCAGAAGTTATAATCTTGGCCTTGGGCTCCATGTC TATGATGAGGTGCCTGACTTCCTTGAAGATATTCTTGCTGCGGATGCTAGGGGCACTGTG AGGCCTCGTGCTTTTATTCTGTAA
PEP MAEGLVWLGSDQLDWEGVVGREVDRRVPTDFLTIGIVKHGGLLEDKNVEIDLVRQVLSQE AREYPNLVTLGNLLNSRLLQRMAGIIKGFTKVVPSPKVVQIVKVEKQRRLKERRPKDKGT RSKRVRKGAKDLLKMQREENGHVTMVMVWDLVYQYALDWYNACKTIVGTPEHTVVKLQWK TPRPSACKVNTDGSRINAIGLSGAGGLLRDATGAWIQGFIVNLGSSTILEAKLWGIFWGF SLAWDPGYRDVEIECDFNTAVTLLSSHIVPTNPLYNIISCCKIKIHEPWCCAIKHIYREQ NVATIALATRSYNLGLGLHVYDEVPDFLEDILAADARGTVRPRAFIL


| Top |