Cherry SNP DataBase

Gene information

Gene Pav_sc0004290.1_g160.1.mk
Chromosome name PAV_r1.0chr1
start 30955081
end 30958209
PAV_r1.0 name Pav_sc0004290.1
start 66829
end 69957
direction -
Annotation NR PREDICTED: uncharacterized protein LOC103320528 isoform X1
Sequence CDS ATGGAAGGAGAACACAGCATACTAGACGCAGTATTTGAAGACGATAACTTTGAAGATGGC GAAGATGTTGAGATGCTTGATGTGGAAGAAGGTGAGCTTGTGGAAGAAGGGGAGCTTGTG GATTTTAACTCACAAAATGGTTCGGGACAGAGCAGTGGTGGCAATGTCAGTGTAGCAAAC CAAGAACGTCAGGGCAAGAATCAGAAGCGCAGGGGTAAGAAGAAGAGGAATAGGAGAAGG AACAGTGGCCCTGGAATTAATGTCACTGACATAGACAGGTTTGTGATGGATACATGTAGG CGACTGAAAGAGAAGAAATCATATCTGGTATATACTGCTGTTGGTTGTCTGGGTGTTCTT GCATTGAATGATCTCGTCAAAGAGGGTCCTGTTATTGGGAGGATGGTTATGCGCCCAGAA ATGCTTTATGGGTTACTTTTAAGGTTGTCTTTACCTCCTGAGCCATCTGTCCCTTTTAAA GTGGATGCGATCCAGGCTTGTGGAGGTCAGATGACTCATGATGGCAAACGTTTCCGATTT GGTGGTGGAGTACTATGGAGTATCATCAAAGCACGAGAACCAAAGGCCTACAAAGAGATA ATGAAAAAAGGAAGGGAATTTGAGAAGCAATTCAGGTCAACAAATAATAGACAACCAATA CAGCAAGGGAAAGAAGGTTCATCTCAAGCAATTGTGAATTCATTCAAGGATGATACTCCA GCTAATGTTTCAGATGCCGTACCGGTTATATGTCAAATGCAAACTCAAGGCATTCAGTCA AATACTGAAGGGAAACAACTTTCTGTTCATGATAGGTTAAGGGTGCCTGTTTCATATGAT GATGACCTGCTTGGAGAGGCGCCCAAAGATGATGCACTTGAATGTTAG
PEP MEGEHSILDAVFEDDNFEDGEDVEMLDVEEGELVEEGELVDFNSQNGSGQSSGGNVSVAN QERQGKNQKRRGKKKRNRRRNSGPGINVTDIDRFVMDTCRRLKEKKSYLVYTAVGCLGVL ALNDLVKEGPVIGRMVMRPEMLYGLLLRLSLPPEPSVPFKVDAIQACGGQMTHDGKRFRF GGGVLWSIIKAREPKAYKEIMKKGREFEKQFRSTNNRQPIQQGKEGSSQAIVNSFKDDTP ANVSDAVPVICQMQTQGIQSNTEGKQLSVHDRLRVPVSYDDDLLGEAPKDDALEC


| Top |