Cherry SNP DataBase

Gene information

Gene Pav_sc0004383.1_g020.1.mk
Chromosome name PAV_r1.0chr8
start 1143943
end 1149019
PAV_r1.0 name Pav_sc0004383.1
start 13452
end 18528
direction -
Annotation NR PREDICTED: probable phosphoribosylformylglycinamidine synthase, chloroplastic/mitochondrial
Sequence CDS ATGGCCGGTGTTCGGGAAATAACGGCTGCTGCTGAATTCTTACAAGGTACCAATAGGCAG AGCCTGTGTTTGCATAGAAATTCTTTTAGAGGAAGAAGCCATGTGCTTTGGGGGGCGGTT CACGGTCGAAGTTCAGAATTGGGTTTTGCTAATAGGAGAGGTGTTTCATTGAGGTGTCGT GCTCAAGAAAAGCCCAGAGCTGTTGTTTCTGGTGGTGTGAGCAGTTTGGTAGATGAGCAA TCAAACTTGGTTGAGAAGCCTGCTGCGGAAGTTATTAATTTTTATCGGGTCCCGCTTATG CAGGAGAGTGCTTCATCTGAGCTTCTCAAGACAGTTCAGACAAAAATTTCAAATCAGATA GTTGGTTTGAAAACTGAGCAGTGTTTCAACATTGGGCTCGATTCACAGCTTTCTAGTGAC AAGCTTCCGGTTCTTAAGTGGCTTCTTCAGGAGACTTTTGAGCCCGAGAATTTGGGGACT GAGAGCTTTCTTGAAAAGAAAAGGCAGGAAGGACTGAATACAGTCATTGTTGAGGTTGGG CCTCGGTTGTCATTTACAACAGCCTGGTCTTCCAATGCTGTCTCAATTTGTCGAGCATGT GGATTGACAGAGGTGACTCGTTTGGAACGGTCAAGGAGGTACTTGTTGTTCAGTAAGGGA ACACTACAAGATCATCAAATTAGTGAGTTTGCTGCAATGGTTCATGATCGGATGACTGAG TGTGTGTATACTCAGAAGCTTGTTTCATTTGAAACGAGTGTAGTTTTGGACGAAGTTCGT CATGTACCTGTCATGGAGAGAGGTCGGAAGGCATTGGAGGAGATAAATCAGGAAATGGGT TTAGCATTTGATGAGCAAGATCTCCAATACTACACTAGGCTATTCAGGGACGAAATCAAG CGGAATCCAACAACAGTTGAACTGTTTGATATTGCACAATCCAACAGCGAGCATAGCAGG CACTGGTTTTTTACTGGTAAAATTCTTATAGATGGACAACCTATGGATAGAACTCTAATG CAGATTGTGAAGAGCACTTTGCAGGCAAACCCAAACAATTCTGTGATTGGGTTCAAGGAT AACTCAAGTGCAATCAAGGGCTTTCTGGTGAAACAAATGCGACCAGTTCAGCCAGGTTCA ACATGTCCGTTGAACATAGCTACTCGGGACCTTGATATTTTATTTACTGCCGAGACACAT AATTTTCCATGTGCTGTAGCCCCTTACCCTGGTGCAGAGACAGGTGCAGGGGGTCGAATT AGGGATACCCATGCAACTGGAAGAGGGTCTTTTGTTGTAGCATCTACAGCTGGTTATTGT GTTGGGAATCTCAATATGGAGGGCTCTTATGCACCTTGGGAAGATCCATCTTTTACATAT CCATCAAATTTGGCTTCACCTCTGCAGATACTCATAGATGCTAGCAATGGTGCATCGGAC TATGGAAACAAATTTGGGGAGCCCTTGATTCAGGGCTACACTAGGACATTTGGAATGAGA CTCCCAAGTGGTGATAGACGAGAATGGTTGAAGCCAATCATGTTTAGTGGGGGCATTGGG CAGATTGATCACACCCATATATCAAAGGGAGAGCCTGACATTGGAATGCTGGTTGTAAAG ATTGGAGGCCCTGCTTATCGGATTGGAATGGGGGGTGGGGCTGCATCAAGCATGGTTAGT GGCCAAAATGATGAGGAGCTTGATTTTAATGCTGTACAGCGTGGAGATGCGGAGATGGCA CAGAAACTTTATCGTGTGGTTCGTGCCTGCATAGAGATGGGGGAGGATAACCCAATCATT AGCATTCATGATCAGGGAGCTGGTGGAAACTGCAACGTTGTTAAGGAAATTATATACCCA AAGGGCGGTCAGATTGATATCCGGGCAATTGTGGTTGGTGATCACACAATGTCTGTCTTG GAGATATGGGGCGCAGAATATCAGGAGCAAGATGCAATCTTGGTGAAGCCTGAAAGCCGC AGCCTCTTGCAATCAATATGTGAAAGAGAAAGGGTTTCTATGGCTGTAATTGGAACAATA AATGGTGAGGGGCGTGTTGTTTTAATTGATAGCGTAGCCATTCAGAAGTGTCAATCCAGT GGACTCCCTCCCCCTCCCCCTGCAGTTGATTTGGAGCTTGAGAAAGTACTTGGTGATATG CCACAAAAAAGTTTTGAATTCCACCGGATGGCAGATGCACGAGAGCCACTTGATATTGCT CCTGGAGTCACAGTGATGGATTCTCTTAAGAGGGTATTGAGACTTCCATCTGTTTGTTCA AAGCGCTTCTTGACATCAAAAGTAGACAGGTGTGTTACAGGTCTTGTAGCACAGCAGCAA ACTGTTGGCCCCCTGCAAATTCCACTTTCTGATGTTGCTGTAATCGCTCAGACTTTTACT GACTTGACTGGAGGTGCATGTGCCATTGGGGAGCAGCCAATTAAAGGTTTGCTGGATCCA AAAGCAATGGCGAGATTGGCTGTTGGAGAAGCACTGACAAATCTTGTTTGGGCAAAGGTC ACTTCTCTATCTGATGTTAAAGCAAGTGGGAATTGGATGTATGCGGCCAAGCTTGATGGG GAAGGAGCAGCTATGTATGATGCTGCTATAGCTCTGTCAGATGCTATGATTGAACTTGGC ATTGCTATTGATGGTGGGAAGGACAGTCTTTCCATGGCAGCTCATGTTGCAGGTGAGGTT ATTAAGGCTCCTGGCAATCTTGTAATGAGTGTATATTGTAGTTGTCCTGACATAACAAAA ACAGTAACCCCCGATTTAAAGCTCGGGGATGATGGCGTGCTGCTTCACATTGATTTGGCA AAGGGAAAGCGGAGGTTAGGTGGGTCTGCTCTTGCTCAGGTTTTTGACCAAATTGGGAAT GAGTGTCCTGACATTGAGGATGTTCGTTATCTTAAGCGAGTTTTTGAAGGAGTTCAGGTC CTTCTTGCTGAGGAATTGATCTCTGCTGGTCATGATATTAGTGATGGTGGGCTATTGGTC TGTGCCCTTGAAATGGCATTTTCTGGGAATCGTGGCATTACCTTGGACTTGACTTCACAT GGGAAGGGCCTATTCCAAACACTTTTTGCTGAAGAACTTGGTCTGATTATCGAGGTAAGC AGGGAAAACTTGGATTTGGTAATGGAAAAACTAAGCAGTGAAAGTATTTCTGCTGAGATC CTTGGACAAGTTAGTGCCACACCCTCAATAGAATTAAAGGTTGATGGGGTAACACATTTG AATGGGAGTACTTCTTCCCTGAGGGACCTGTGGGAGGAAACTAGTTTTCAGCTGGAAAAA TTTCAAAGATTGGCTTCTTGTGTGGATCTAGAGAAAGAAGGGTTGAAAGATAGGCATGAG CCTTCATGGGAATTGTCTTTCACTCCTTCTTTCACAGATGAAAAGTATATGAGCATTGCA TGCAAACCCAAAGTGGCTGTAATTCGAGAAGAAGGCAGCAATGGGGACAGAGAAATGGCT GCAGCATTTTATGCTGCTGGTTTTGAACCATGGGATGTTACAATGTCAGACCTTCTTAAT GGATCCATATCACTGCATGAATTCCGTGGAATTGTGTTTGTTGGAGGTTTTAGCTACGCT GATGTGCTCGATTCTGCAAAGGGTTGGTCTGCTTCCATTCGATTTAATCAGCCCCTTCTA AATCAATTTCAGGAGTTTTACAAGCGACCAGACACTTTTAGTCTTGGTGTTTGCAATGGC TGTCAGCTTATGGCTCTTTTGGGGTGGGTTCCGGGTCCTCAAGTTGGTGGAGTGTTAGGT GGTGGTGGCGACCCTTCACAACCCAGGTTCATTCACAACGAGTCGGGACGGTTTGAATGC CGGTTCACCAGTGTGACAATAAAGGACTCGCCGGCTATAATGTTTAGAGGAATGGAGGGC AGTACATTAGGTGTGTGGGCTGCCCATGGTGAGGGAAGAGCATATTTCCCTGATGACGGT GTTTTTGATCGTGTGCTACACTCAAAGTTGGCACCAGTAAGATATTGTGATGATGATGGT AATGAGACAGAACTTTACCCTTTCAACCTCAATGGCTCTCCGTTAGGAGTTGCGGCAATT TGTTCTCCAGATGGGAGGCATCTTGCGATGATGCCTCATCCAGAGCGTTGCTTCTTAATG TGGCAATTCCCATGGTATCCCCAGCAGTGGGATGTGGACAAGAAAGGCCCTAGCCCGTGG TTGCGGATGTTCCAAAATGCCAGAGAGTGGTGTTCTTAA
PEP MAGVREITAAAEFLQGTNRQSLCLHRNSFRGRSHVLWGAVHGRSSELGFANRRGVSLRCR AQEKPRAVVSGGVSSLVDEQSNLVEKPAAEVINFYRVPLMQESASSELLKTVQTKISNQI VGLKTEQCFNIGLDSQLSSDKLPVLKWLLQETFEPENLGTESFLEKKRQEGLNTVIVEVG PRLSFTTAWSSNAVSICRACGLTEVTRLERSRRYLLFSKGTLQDHQISEFAAMVHDRMTE CVYTQKLVSFETSVVLDEVRHVPVMERGRKALEEINQEMGLAFDEQDLQYYTRLFRDEIK RNPTTVELFDIAQSNSEHSRHWFFTGKILIDGQPMDRTLMQIVKSTLQANPNNSVIGFKD NSSAIKGFLVKQMRPVQPGSTCPLNIATRDLDILFTAETHNFPCAVAPYPGAETGAGGRI RDTHATGRGSFVVASTAGYCVGNLNMEGSYAPWEDPSFTYPSNLASPLQILIDASNGASD YGNKFGEPLIQGYTRTFGMRLPSGDRREWLKPIMFSGGIGQIDHTHISKGEPDIGMLVVK IGGPAYRIGMGGGAASSMVSGQNDEELDFNAVQRGDAEMAQKLYRVVRACIEMGEDNPII SIHDQGAGGNCNVVKEIIYPKGGQIDIRAIVVGDHTMSVLEIWGAEYQEQDAILVKPESR SLLQSICERERVSMAVIGTINGEGRVVLIDSVAIQKCQSSGLPPPPPAVDLELEKVLGDM PQKSFEFHRMADAREPLDIAPGVTVMDSLKRVLRLPSVCSKRFLTSKVDRCVTGLVAQQQ TVGPLQIPLSDVAVIAQTFTDLTGGACAIGEQPIKGLLDPKAMARLAVGEALTNLVWAKV TSLSDVKASGNWMYAAKLDGEGAAMYDAAIALSDAMIELGIAIDGGKDSLSMAAHVAGEV IKAPGNLVMSVYCSCPDITKTVTPDLKLGDDGVLLHIDLAKGKRRLGGSALAQVFDQIGN ECPDIEDVRYLKRVFEGVQVLLAEELISAGHDISDGGLLVCALEMAFSGNRGITLDLTSH GKGLFQTLFAEELGLIIEVSRENLDLVMEKLSSESISAEILGQVSATPSIELKVDGVTHL NGSTSSLRDLWEETSFQLEKFQRLASCVDLEKEGLKDRHEPSWELSFTPSFTDEKYMSIA CKPKVAVIREEGSNGDREMAAAFYAAGFEPWDVTMSDLLNGSISLHEFRGIVFVGGFSYA DVLDSAKGWSASIRFNQPLLNQFQEFYKRPDTFSLGVCNGCQLMALLGWVPGPQVGGVLG GGGDPSQPRFIHNESGRFECRFTSVTIKDSPAIMFRGMEGSTLGVWAAHGEGRAYFPDDG VFDRVLHSKLAPVRYCDDDGNETELYPFNLNGSPLGVAAICSPDGRHLAMMPHPERCFLM WQFPWYPQQWDVDKKGPSPWLRMFQNAREWCS


| Top |