Cherry SNP DataBase

Gene information

Gene Pav_sc0004456.1_g180.1.mk
Chromosome name PAV_r1.0chr6
start 23955799
end 23962855
PAV_r1.0 name Pav_sc0004456.1
start 95856
end 102912
direction -
Annotation NR PREDICTED: putative leucine-rich repeat receptor-like serine/threonine-protein kinase At2g19230
Sequence CDS ATGCCTCAGGGGGATATGACAGAAAGAAACTTTTCTTATTCTTCCAAGCTTATCATCTTA TTCATTGCCACTGTTTTTATCCGAACTTTTTCCCAGACTCCACCTTCACCTGATGGTCCC TCAGGAAGCTGTGTGTTAAATTTCACATCCTACCCGTTCCAACCAACTGGGGAGTGCATC AGTCATTTGGGACAGAGAATCAACATGTGGGGCAGCTACCCTACAAACCTGTGCTGTCGA AATGTCCTCCCCGTCATGTCCCAAGCCTTAGCCATTCATGTAGTTAAGACACAGGGGCAG GGCAGTGTCTTTCTTGCACAAGAGGAATGGCAGAGCTGCAGCGGCCCTTTACAAACGCAG CAGAGTGTGTCTGCGCAACAGTGCGGCTTTGATGACCTTAACAGTAGAAGTAGCCAGTGC TCCAGAACAACTCTTTCAGGCCTTAGCCAAGACCAGCCCTTCCTAGACGCACTAAGGAAC TGCTCTCAATTTGGCAATGCATTTGATGGTGTTTGCAGAAATTGCACCCAGGCAATCTTA GCTCTGAGGGACTTTTTATTGAAAAAGTATGGCGTGAAGGACGAGAACAAAACTGAAACA GCCATATGTGGTGTAGCTGCTATGATTTCTATTGCAGCAGCAAATATGAAAGGTTCCTTT TCGGTCGATATTGACTACATTCAGTGTTTGTCTATGTTAGACAAGTTTGATTCTTTGGCA GAGGCGATATTTTCAATCTTAATAGCCATCACTGCAGTGATGCTGATCGTCCTGCTGATT AAATATGTGAGCAAGAAGAAGCCTCAAAAACCGGTTCAATCAGGACCAATTACTACATGG TCCGGCCTGTATAGATTCTCCAAGGCTGAGATTGAGAATGCCATAAATTTTGAGAGAAAG GACCTTGGAAGAGGAAGTGCTGGTCAAGTTTATAAAGGTGTTCTTCCTAGTGGACAAGTC GTGGCCATTAAGCACATAAACAAGAGCAATACTTCTGATTCTTTTACACGAGAAGTCGAA GGTCTTTCAAGGGTTCGACATCCAAATTTGGTTTGCCTCTTTGGTTGCTGCGTTGAAGAT GGAGAGCAATTTCTTGTGTACGAGTATTGCGCAGCAGGGAATCTAGCTCAACACCTCCTA AGAAATGATCCTGTCTTAACATGGGAAAGAAGAGTTAAGATTCTGAGAGATTGTGCGCTT GCTTTGAGGTATCTCCACCACTATATAGATGGATGCATTGTTCACAGAGATATTAAGGCA AAGGATATAAGTATGAACAAGCGCCCACCTGAGGATCTTGAGGACCCAAGACTAAATGGA AATGTCAACAAGGTGGACTTTGAATCAATCCTACAAGTTGCAGTACTTTGTGTTGCCAAA TCAAGCAAAGGTCGCCCAACAATCGATCTCGTGTACGAAGAGATGGACAAGGCTTGGAAG AACACTCTTGCTGACATGAAGAAGGCAAAGAAAGGGATAAGTTCCTCAGCAACACCACTG TCTATATCTTCGGATGTACCAACGTTTTACACAATATACAAGAAGAAATCATCCAAAGGC TTCCAATCCATACCTTATGTGGTTGCCCTTCTTAGTGCAATGCTGTTATTGTATTATGGT GTCCTCAAGACCAATGCCTTTTTGATCATCAGCATCAATGGCATCGGATGCGCTATAGAA ATTATTTACCTCATATTCTACATTGTATATGCATCCAAGAAGGACAAGATTACTACAATG AGTTTGATACTGCTGGTGAACGTAGCGGCCTTTGGGTTGGTGATGGCGGTTACAGTCTTT CTTCTAGGAGAAGCCAAGCGTGTTAGCGCTGTTGGATGGTTATGTGCTGTGTTCAACATT GCTGTCTTTGCTGCTCCTTTAAGCATCATGAGGCAAGTAATAAGAACCAACAGTGTAGAA TACATGCCATTTTCTTTGTCATTTTTCCTCACACTTTGTGCAACCATGTGGTTCTTCTAC GGCCTCTTCACAAAGGATTATTACATTGCATTACCAAATGTGTTGGGATTCTTATTAGGC ATCGCTCAAATGATCCTATACCTCACATACAAGAATTCAGGGAAAAATGATGCAGAAAAT AAAGGCAGTCAAGAGATGAAGAAGTTCATGAGCCGCAACCGCCCAAAGCTAATGCGCAGT GTTAGTGATTTACCCAGAGCAGATAAATTGATGCAGACTACGTATGTCTTCAATCAGCAG CAGCAGCAGGAATCGAACGACAACCACGTATAG
PEP MPQGDMTERNFSYSSKLIILFIATVFIRTFSQTPPSPDGPSGSCVLNFTSYPFQPTGECI SHLGQRINMWGSYPTNLCCRNVLPVMSQALAIHVVKTQGQGSVFLAQEEWQSCSGPLQTQ QSVSAQQCGFDDLNSRSSQCSRTTLSGLSQDQPFLDALRNCSQFGNAFDGVCRNCTQAIL ALRDFLLKKYGVKDENKTETAICGVAAMISIAAANMKGSFSVDIDYIQCLSMLDKFDSLA EAIFSILIAITAVMLIVLLIKYVSKKKPQKPVQSGPITTWSGLYRFSKAEIENAINFERK DLGRGSAGQVYKGVLPSGQVVAIKHINKSNTSDSFTREVEGLSRVRHPNLVCLFGCCVED GEQFLVYEYCAAGNLAQHLLRNDPVLTWERRVKILRDCALALRYLHHYIDGCIVHRDIKA KDISMNKRPPEDLEDPRLNGNVNKVDFESILQVAVLCVAKSSKGRPTIDLVYEEMDKAWK NTLADMKKAKKGISSSATPLSISSDVPTFYTIYKKKSSKGFQSIPYVVALLSAMLLLYYG VLKTNAFLIISINGIGCAIEIIYLIFYIVYASKKDKITTMSLILLVNVAAFGLVMAVTVF LLGEAKRVSAVGWLCAVFNIAVFAAPLSIMRQVIRTNSVEYMPFSLSFFLTLCATMWFFY GLFTKDYYIALPNVLGFLLGIAQMILYLTYKNSGKNDAENKGSQEMKKFMSRNRPKLMRS VSDLPRADKLMQTTYVFNQQQQQESNDNHV


| Top |