Cherry SNP DataBase

Gene information

Gene Pav_sc0004570.1_g040.1.br
Chromosome name PAV_r1.0chr0
start 77386073
end 77387733
PAV_r1.0 name Pav_sc0004570.1
start 9263
end 10923
direction +
Annotation NR
Sequence CDS ATGAAGCACATCTCCCTCTCGTCGTCCACCGAACTAGCCGAGATCGCCATCTCCGTCACG CCGTTTAGGACACCGAGTTCGCCGAGATTGCTATCTCCATCGCTCCGTTCAGTCCACCGA GCTGGCCGTGTTCGCCATCTCCCGCTCGCTTCCCATGGCAGTTACCCTTCCTCATCTCGA CCATTTTTAAGCCCCAAATGGATTCCCATCTTCCATTTTACGAGCTTTAGATTAGATCTT TTTCCTCGTAGACTAGAAAGGCAGATACGGTTTCCTAGCTGTGAGGCCTTGGGAAGGTTA AACTGCGGAAAAACTCTTTTATCATGCAACTGCAGGGCACCAAAACTATTAGAAGGAGAT CCTATGGACATGATTGGTTTCTTTGGAAGTTATGGTCAGAGTTTCTTCAATTCTGTTGAC ATAGGAGTTGTTTATTTCAGGTCTTGGCTCTTAAATGATCTTGTCATGGTGATACTTTGG GTGCTATGGAAGCAAAAGCACCATCATCTTATACAGGCTTCCTCCAACAACCATGGTATG AATTTTCTGTCACAAGATACTTGA
PEP MKHISLSSSTELAEIAISVTPFRTPSSPRLLSPSLRSVHRAGRVRHLPLASHGSYPSSSR PFLSPKWIPIFHFTSFRLDLFPRRLERQIRFPSCEALGRLNCGKTLLSCNCRAPKLLEGD PMDMIGFFGSYGQSFFNSVDIGVVYFRSWLLNDLVMVILWVLWKQKHHHLIQASSNNHGM NFLSQDT


| Top |