Cherry SNP DataBase

Gene information

Gene Pav_sc0004605.1_g020.1.br
Chromosome name PAV_r1.0chr5
start 7430358
end 7432280
PAV_r1.0 name Pav_sc0004605.1
start 15722
end 17644
direction -
Annotation NR PREDICTED: subtilisin-like protease SDD1
Sequence CDS ATGGAGACAGAAAAGGGTATGGCATTGCAGGTTATATATCTTGTTGGTTTAACTTTCATG TTTTATTTATCACTCGCAATTGCACAAGAGGAGCAAAACAATCTGCAAACATATATCATT TGGGTTGAAAAGCCGGTGTCCCAGAATTCTTTTGCACAATCTCATGAAGACCTGGAGAGT TGGTATCAGTCATTTTTGTCTGAAACCAGTGAAAACTCAAACCAGCTGATGAAGCAAAGA ATGGTTCATACATACCGTAATGTGGCCATAGGGTTTGCAGCAAAACTGATGCCAGAGGAA GTAAAGGCAATGGAAAAGAAAGAAGGGTTTGTGTCAGCTCATCCCGAGAGAATTCTGCCT TTGCAGACTACTCATAGTCCTGACTTCTTGGGTTTACACCAAGGGTCGGGACTTTGGGAA CAAACAAACTATGGTGAAGGCGTTATCATTGGAGTTTTGGATACTGGTGTTGCACCATAT CATCCTTCATTTAGTGATGAAGGAGTATCCCCTCCTCCGGCTAAATGGAAAGGCAAATGT GACTTCAATGCGACATTGTGCAATAAAAAACTTATCGGTGCGAAAGATTTCATAGGCTCA AGCAAAGGGAAACCTACAGGGAGCGCTCCATTTGACCAAGATGGCCATGGCACCCACACT TCTAGCACAGCTGCTGGAAATTTTGTGGAAGGCGCAAGCGCATTTGGAGTGGCGAATGGC ACAGCTGTTGGCATGGCACCTTATGCTCACTTGGCCATTTACAGAGTCTGCGACTTTGGT TGTGCTGAAGGTGACATTTTGGCGGCAATGGATGCTGCTGTTGAAGATGGCGTGGACGTG CTCTCCCTCTCACTTGGCGGTCCCTCGATTCCTTTCTATGGGGATGTGATTGCAGTTGGT GCATTTGGAGCAACTCAGAAGGGAATTTTTGTCAGCTGTGCAGCTGGAAACTCTGGTCCT TACCATGGTTCTTTATCAAATGAGGCTCCATGGATTCTCACTGTTGGAGCAAGCACCACA GACAGAATATTAAACTTAACCTCAACACCTACATCCACAATCTTGTTCAATGGCGCCGCA TCAGATCCACTCGCTCCAAAGGTCGCTACCTTTTCATCAAGAGGACCAAATACTGCAAGC CCTGGAATTCTGAAACCTGATATCATTGGACCAGGTGTTGACATCCTAGCTGCATGGCCT GTTTCTGTGGACAATGCCACAAAGTCTAACGCAACATTCAACATAATTTCGGGTACCTCA ATGTCAACTCCTCACTTAAGTGGCATTGCAGCCTTGCTCAAGAGCTCTCACCCTGACTGG TCACCAGCTGCAATCAAATCTGCCATCATGACAAGCGCCAATGTACTGAACCTTGCAGGG TTGCCCATTGTTGATCAAAGACTTAATCGCGCGGACGTATTTGCAATCGGTGCAGGCCAT GTTAACCCTACAAAAGCAAATGACCCAGGGCTCATCTACGACACACAACCTAAGGATTAC ATTCCTTACTTGTGTGGTTTGAATTACACAGAAAAAGAGATACAGATCATCACCCAACAA AAAGTGAACTGCTCTCAAGTCGGGGTCATACCAGAAGCACAGCTCAATTATCCTTCATTT TCTATTAAGATAGGGTCCAATGAGTCTCAGTCTCAGTATTATACAAGGACCGTGAGGAAT GTCGGCCCGGCTAGTTCAACTTACAACTTGGATCTTCTTGTACCACATAAAATGGGCATG AGTGTGAATCCTGAGGTACTTACATTCACAGAGGTCAACCAGGAGATTACATACCATGTG GAGTTTATTGCAGAAGATGGTGCTGGCAAGGATGGTGTAGCATTTGGTCAGGGGTATTTA AGATGGGTTTCTGATAAGCATAATGTTACTAGCCCAATAGCTGTGATCTTTGACTCTAAG TAG
PEP METEKGMALQVIYLVGLTFMFYLSLAIAQEEQNNLQTYIIWVEKPVSQNSFAQSHEDLES WYQSFLSETSENSNQLMKQRMVHTYRNVAIGFAAKLMPEEVKAMEKKEGFVSAHPERILP LQTTHSPDFLGLHQGSGLWEQTNYGEGVIIGVLDTGVAPYHPSFSDEGVSPPPAKWKGKC DFNATLCNKKLIGAKDFIGSSKGKPTGSAPFDQDGHGTHTSSTAAGNFVEGASAFGVANG TAVGMAPYAHLAIYRVCDFGCAEGDILAAMDAAVEDGVDVLSLSLGGPSIPFYGDVIAVG AFGATQKGIFVSCAAGNSGPYHGSLSNEAPWILTVGASTTDRILNLTSTPTSTILFNGAA SDPLAPKVATFSSRGPNTASPGILKPDIIGPGVDILAAWPVSVDNATKSNATFNIISGTS MSTPHLSGIAALLKSSHPDWSPAAIKSAIMTSANVLNLAGLPIVDQRLNRADVFAIGAGH VNPTKANDPGLIYDTQPKDYIPYLCGLNYTEKEIQIITQQKVNCSQVGVIPEAQLNYPSF SIKIGSNESQSQYYTRTVRNVGPASSTYNLDLLVPHKMGMSVNPEVLTFTEVNQEITYHV EFIAEDGAGKDGVAFGQGYLRWVSDKHNVTSPIAVIFDSK


| Top |