Cherry SNP DataBase

Gene information

Gene Pav_sc0004637.1_g010.1.mk
Chromosome name PAV_r1.0chr7
start 7538008
end 7549499
PAV_r1.0 name Pav_sc0004637.1
start 4041
end 15532
direction +
Annotation NR PREDICTED: protein ARABIDILLO 1
Sequence CDS ATGAGTCGTAGGGTGCGGCGGAAGGTGGCTAGGAAGGGTAAGGAGAAGGTGGTTTTGCCT TGTTATCCAGAAATTGAAGAAGAAGTTTCAGGTTCAGTGCAAAATTGGATTGTTGATTGG ACTAGTTTGCCAGATGATACAGTAATCCAGTTGTTTTCGTGTCTGAACTATCGTGATCGG GCAAGCTTATCATCAACTTGCAAAACATGGAGAGTTCTTGGAATTTCTCCATGTTTGTGG ACCTCTTTGGATCTTAGGGCACACAAATGCAATGATGCCATGGCAGCTTCACTTGCTGCA AGATGTGTGAATCTTCAGAAGCTTCGGTTTCGGGGAGCAGAATCTGCCGATGCAATATTG CATCTTCGTCGGTTTCGGGGAGCAGAATCTGCTGATGCAATATTGCATCTTCGGGCCAGG AATTTACGTGAAATAAGTGGTGATTACTGCAGAAAAATAACTGATGCTACACTTTCTGTG ATTGTGGCTCGGCACGAGGCACTTGAAAGCCTCCAGCTTGGGCCAGATTTCTGTGAAAGG ATCAGCAGTGATGCTATAAAAGCAATAGCTATTTGCTGTCCTAAATTGAAAAAGCTTCGA CTTTCGGGAATTAGGGATGTTCACGCTGATGCTATTATTGCTTTAACTAAGAATTGTCAA AATTTGACTGATATCGGGTTCATAGACTGTCTGAACATTGACGAGATGGCATTGGGAAAT GTTTTATCAGTTCGTTTTCTCTCTGTAGCAGGGACGTCAAATATGAAATGGGGTGTGGTT TCACATCTTTGGCATAAGTTGCCTAACTTGACTGGGCTAGATGTTTCAAGAACTGATATT GGTTCGGCAGCTGTTTCACGGTTATTATCATCATCACAGAGCTTGAAGGTTTTATGTGCC TTGAATTGTCCTGTGCTTGAAGAAGACACCAACTTTGCTCCTCGTAAATATAAAAATAAA TTGTTACTTGCCCGTTTTACAGAAATTATGAAAGAAATAGCTTTTTTATTAGTCGACATT ACAAAGAAAGGGAAGAATGTGTTTTTGGATTGGAGGAATTCAAAGAACAAGGATAAGAAC TTGGATGACATAATGACTTGGATTGAGTGGATTCTCTCTCATACTCTTTTGCGCATTGCC GAGAGCAATCAACAGGGTTTAGATGTTTTTTGGCTCAAGCAGGGCGCATCACTGTTGCTC AATTTAATGCAAAGCTCACAAGAGGATGTGCAAGAAAGGGCAGCTACGGGACTTGCAACT TTTGTTGTTATTGATGATGAAAATGCTAGCATAGATTGTGGGAGGGCTGAAGCGGTTATG CGGGATGGTGGCATACGCCTTCTCCTAAACCTAGCAAAATCTTGGAGGGAAGGGCTCCAA TCAGAGGCTGCTAAGGCTATAGCAAACTTGTCTGTTAATGCCAATGTTGCAAAAGCTGTT GCTGAGGAAGGAGGAATCAATATTCTCGCTGGTTTGGCAAGGTCTATGAACAGGCTGGTT GCAGAAGAGGCTGCTGGAGGACTCTGGAATCTTTCCGTTGGAGAAGAGCACAAGGGTGCC ATTGCGGAGGCTGGTGGAGTAAAAGCTTTAGTTGATCTTATCTTCAAATGGTCCTCTGGT GGTGATGGAGTTCTGGAACGTGCAGCTGGTGCACTGGCGAATTTAGCTGCTGATGACAAG TGTAGCACAGAGGTTGCAGTGGCAGGTGGTGTGCAGGCTTTGGTGATGCTTGCTCGTAAC TGCAAGTTTGAGGGAGTGCAAGAGCAGGCTGCCCGTGCCTTGGCGAATTTGGCTGCTCAT GGAGATAGTAATAGTAATAATGCTGCAGTTGGACAAGAGGCAGGTGCTCTTGAAGCACTT GTTCAGCTTACACAATCTCCTCATGAAGGTGTCAGGCAAGAGGCAGCTGGTGCATTGTGG AATCTATCGTTCGATGACAGAAACCGAGAAGCAATTGCTGCAGCTGGCGGTGTTGAGGCC TTGGTTGCTCTTGCACAAGGCTGCTCAAACGCCTCCCCAGGTCTTCAAGAAAGGGCTGCT GGTGCTCTTTGGGGATTATCAGTGTCAGAAGCCAATAGCATTGCCATTGGACGGGAAGGA GGTGTTGTGCCTTTGATTGCATTGGCACGTTCTGAAGCTGCAGATGTCCATGAAACGGCT GCAGGTGCTCTTTGGAATCTTGCTTTTAACCCTGGTAATGCTCTCCGTATTGTGGAAGAA GGAGGTGTTCCTGCACTTGTTAATCTTTGTTCTTCATCGGTGTCAAAAATGGCTCGCTTC ATGGCTGCATTGGCATTGGCGTACATGTTTGATGGCAGAATGGATGAATTTGCCTTGATA GGGACTTCATCAGAAAGCATCTCAAAGAGTGTGAGCTTAGATGGCTCTAGAAGGATGGCT CTTAAGCACATTGAGGCCTTTGTCCTCACATTTTCTGATCAGCAAACGTTTTCTGCTGCT GCAGCATCATCAGCCCCTGCAGCATTGGCACAAGTGACTGAAGGTGCTCGTATTCAAGAA GCAGGACATCTGAGATGCAGCGGGGCTGAAATTGGAAGATTTGTTACCATGCTACGGAAT CCATCATCTGTTCTCAAGGCATGTGCTGCATTTGCTCTTCTTCAGTTTACCATTCCTGGT GGCCGGCATGCCATGCACCATGCCAGCCTTATGCAGAATGCAGGAGCAGCACGCGTTCTG CGGGCTGCAGCTGCTGCAGCAACTGCTCCGCTTGAAGCCAAAATCTTTGCTAGAATTGTG CTTCGCAATCTTGAGCATCACCATATAGAACCATCACTCTAA
PEP MSRRVRRKVARKGKEKVVLPCYPEIEEEVSGSVQNWIVDWTSLPDDTVIQLFSCLNYRDR ASLSSTCKTWRVLGISPCLWTSLDLRAHKCNDAMAASLAARCVNLQKLRFRGAESADAIL HLRRFRGAESADAILHLRARNLREISGDYCRKITDATLSVIVARHEALESLQLGPDFCER ISSDAIKAIAICCPKLKKLRLSGIRDVHADAIIALTKNCQNLTDIGFIDCLNIDEMALGN VLSVRFLSVAGTSNMKWGVVSHLWHKLPNLTGLDVSRTDIGSAAVSRLLSSSQSLKVLCA LNCPVLEEDTNFAPRKYKNKLLLARFTEIMKEIAFLLVDITKKGKNVFLDWRNSKNKDKN LDDIMTWIEWILSHTLLRIAESNQQGLDVFWLKQGASLLLNLMQSSQEDVQERAATGLAT FVVIDDENASIDCGRAEAVMRDGGIRLLLNLAKSWREGLQSEAAKAIANLSVNANVAKAV AEEGGINILAGLARSMNRLVAEEAAGGLWNLSVGEEHKGAIAEAGGVKALVDLIFKWSSG GDGVLERAAGALANLAADDKCSTEVAVAGGVQALVMLARNCKFEGVQEQAARALANLAAH GDSNSNNAAVGQEAGALEALVQLTQSPHEGVRQEAAGALWNLSFDDRNREAIAAAGGVEA LVALAQGCSNASPGLQERAAGALWGLSVSEANSIAIGREGGVVPLIALARSEAADVHETA AGALWNLAFNPGNALRIVEEGGVPALVNLCSSSVSKMARFMAALALAYMFDGRMDEFALI GTSSESISKSVSLDGSRRMALKHIEAFVLTFSDQQTFSAAAASSAPAALAQVTEGARIQE AGHLRCSGAEIGRFVTMLRNPSSVLKACAAFALLQFTIPGGRHAMHHASLMQNAGAARVL RAAAAAATAPLEAKIFARIVLRNLEHHHIEPSL


| Top |