Cherry SNP DataBase

Gene information

Gene Pav_sc0004735.1_g060.1.mk
Chromosome name PAV_r1.0chr7
start 6035351
end 6037432
PAV_r1.0 name Pav_sc0004735.1
start 13595
end 15676
direction -
Annotation NR PREDICTED: ras-related protein RABA4d
Sequence CDS ATGTCGAATTTGTACGGAGATTACAATCAGAAAATTGATTATGTGTTCAAAGTGGTGTTG ATTGGAGACTCGGCGGTTGGAAAAACACAGCTGCTAGCGCGCTTTGCTAGAAATGAATTC AGTGTGGACTCGAAAGCCACAATCGGGGTCGAATTTCAGACGAAAACTCTTATTCTCGAT CACAAAACGGTGAAGGCGCAGATTTGGGACACTGCTGGCCAAGAAAGGTACAGAGCTGTC ACGAGTGCATACTACCGAGGCGCAGTCGGAGCAATGCTGGTTTATGACATGACAAAGCGC CAATCATTTGATCACATGGCTAGGTGGTTGGAGGAATTAAGGGGCCATGCTGATAAGAAC ATTGTTATAATGCTCATTGGCAACAAATGCGACTTGGGAAGTCTCCGAGCAGTGCCAACT GAAGATGCTCAGGAGTTTGCTCAAAGAGAGAACCTATTTTTTATGGAGACATCTGCTCTT GAAGCCACCAATGTTGAAACCGCCTTCTTGATGATTTTAATGGAGATATACCGGATAATG AGCAAGAAGACCCTTGCTTCCAATGGTCAAGATGGTGGAGATTCAGGGCTTCTAAAGGGA ACTGCGATTATTGTTCCTAGTCCAGAGTCGGATGCCTCCAGGAAGGGGGGCTGCTGCTTT TCCTCCTAA
PEP MSNLYGDYNQKIDYVFKVVLIGDSAVGKTQLLARFARNEFSVDSKATIGVEFQTKTLILD HKTVKAQIWDTAGQERYRAVTSAYYRGAVGAMLVYDMTKRQSFDHMARWLEELRGHADKN IVIMLIGNKCDLGSLRAVPTEDAQEFAQRENLFFMETSALEATNVETAFLMILMEIYRIM SKKTLASNGQDGGDSGLLKGTAIIVPSPESDASRKGGCCFSS


| Top |