Cherry SNP DataBase

Gene information

Gene Pav_sc0004766.1_g050.1.mk
Chromosome name PAV_r1.0chr2
start 9704070
end 9709398
PAV_r1.0 name Pav_sc0004766.1
start 22407
end 27735
direction -
Annotation NR conserved hypothetical protein
Sequence CDS ATGGCAGGCCTTCCTACGTCATCGTTTAAGGCAAACACCGGTAGTGCCGCTGCAGAAGAC CCCAAACTCGGTCTCATGAAGCAGATACGGAGCCACGAGGTTGCAATTGCAGAGCTCAAT GCTCTTTCACCGTCTCGGGCTGTCTATCAGAAGAATGGGAACTTGTTTTTCCGTACAACA ATCCAGAAAGCAACGACATCTGAACAAAAACAAATTGATTTGGCTAAAGCAAGCCTAGGA AAGCTGAATTCTTCTTGA
PEP MAGLPTSSFKANTGSAAAEDPKLGLMKQIRSHEVAIAELNALSPSRAVYQKNGNLFFRTT IQKATTSEQKQIDLAKASLGKLNSS


| Top |