Cherry SNP DataBase

Gene information

Gene Pav_sc0004999.1_g070.1.mk
Chromosome name PAV_r1.0chr1
start 41649689
end 41651661
PAV_r1.0 name Pav_sc0004999.1
start 64264
end 66236
direction +
Annotation NR PREDICTED: transcription factor IIIA-like isoform X1
Sequence CDS ATGACCAAAAAAAAAAAAAAAAAACCAGTGGGTCTCAAAGTCCAAACGCCGTTGCTTGTT TCGTTGGTGGGCGAGACTTTCAGAGTTGGTGCATTGGCTATGGATAAAGGTCAAGCAGAA ATGGAGGGGCCTATTTTCAGGGACATAAGGCGATATTACTGCGAGTATTGTGGAATCTGC AGGTCCAAAAAGTCTCTGATTACTTCTCACATCCTCTCCCACCACAAGGATGAGATGGAA ATGTCTAATGTTGATGAAGATCGAGAAGTTGAGCAGAAAAAATCTAATACTTGCCAAGAG TGTGGTGTCACTTTCAGAAAACCTGCACATCTCAAGCAGCATATGCAAAGTCACTCACTT GAGGTATTGTTTATCGTCCATATTCAAAACAAGCTGAGGCCTTTGAACAAAAAAAGGACT GATAAATTGTCTTCTAGCCTGAGATTTCTTGAACTAAGCTTACAGTTTAAGCTAGACACA GTGGAGGCATTCTGCTCTGAACCAGGTTGTATGAAACACTTTACGAATGAGCAATGCCTT CAGGCCCATATCCATTCCTGCCACCAACATACTACCTGTGAGATTTGTGGGACCAAGCAA CTGAGAAACAACCTCAAAAGGCATCTTCTCACACATGAAGATAAACATTCAATAGAGAGG ATTAAATGCGATTATAAGGGTTGTCTTCATACATTTACAACTGTAAGTTGCTGA
PEP MTKKKKKKPVGLKVQTPLLVSLVGETFRVGALAMDKGQAEMEGPIFRDIRRYYCEYCGIC RSKKSLITSHILSHHKDEMEMSNVDEDREVEQKKSNTCQECGVTFRKPAHLKQHMQSHSL EVLFIVHIQNKLRPLNKKRTDKLSSSLRFLELSLQFKLDTVEAFCSEPGCMKHFTNEQCL QAHIHSCHQHTTCEICGTKQLRNNLKRHLLTHEDKHSIERIKCDYKGCLHTFTTVSC


| Top |