Cherry SNP DataBase

Gene information

Gene Pav_sc0005024.1_g050.1.mk
Chromosome name PAV_r1.0chr6
start 15506277
end 15512394
PAV_r1.0 name Pav_sc0005024.1
start 19209
end 25326
direction -
Annotation NR hypothetical protein PRUPE_ppa017151mg
Sequence CDS ATGGAGAAACGGCTTCGCTCTGCTCTCCGATCCTCAGCCGACGAATTTCTGAGCTCGGCC ACAAAGCAAACCCTAAAATCCTCAAAGCCCGCTCTCAAAACCCTAATTCACGCCATCAAT CCTTCCTCCGACCTCTCCTCTTCTCTCCCTCTCTCTCTCTGCAACTCCATTTCCCAAACC ATCCAATCCTTCCAGAACCTTCTAGACCCTAACTCAAACCCGAACCCTAAGCCTAGTTCC CCACGCTCTCCTCCCACCAAGCGCCTCCGGAGGTCGTCTCGGAGGTCCAAGACCTGGTCC GAACCCGAACCAGACGATCCCGACCCGAATCCTGACCGGCAAAAGCAGCGGCTTCTTTCC GAGCTTCAAGTTTTAGCTTTTATCACGCAACTATGCGTTTCGCATCCCCAAAATGCGTTC TCGCCATTGGATTTGTTGGCCGGAGTTCAGGCGCTGCACGACAATTTGATCATTTTGGAG TCGGATTCAGTGCTGGTATCGGAGATAGCGAGTTTGTGCGAGCAATGGTGGAAGGAGGAG TTGCCGGGGCGAGAATCTCTGATTTCTCAGTCGCTCCCTTTCTTGCTGTCTCGATCTCTG ACTCTGAAGAAGAAGGCGGATGTCCACAGAGTCTACGCGCTCCGCGAGGCCTTTGCGTGC TTCGATTTCGAGGATGATAGCATTGAAGACTTGAAGCAGTTGTTAATCCGGTGTGTGATT TCGCCTCTGTATCTAAAGACAGAGGAGGGGAAGAAGTTCCTTGCTTTTCTGTTCGGTTTG AGTTCCCAGCTGTTGAAGGAAGTGTTGGCAATGATTGGGTCTCAGGTTCCGTTTGGACGA AAGTCGATGCTAGAGGCTTATGGGGATGTTCTGTTTCGGGCTTGGAAAGTGTTGGAGGGG GACTCAAGAAGTGAAATTGAAAATGGTTTTTTGCAGGGTTTGATTGACGGTGCAATACAT GCCAGTTCTGGAGCTTTGGCTGCTTCAATTAGAAGGGTTTTGGGAGGGTTTATAAACCAG AGGACCACTGCTGGTGTTGAGAAGCTTCTTTTCCAGCTCTCTGAGCCTGTGATATTTCGC TCTCTGCAGGTTGCGAATTCTAATGTTCGTCAAAATGCGCTGCATTTGATTCTAGACTTG TTCCCTCTTGAAGATCCTGATTCCACAAAAGAGGTGAAAGATTCGTTGCTTGATAAGCAG TTCTTTTTGTTGGAGAGATTACTGGCTGACGACTGTCCTGATGTGAGAGTGGTTGCGGTG GAAGGTTCTTGTCGCATCCTTCATCTCTTTTGGGAAATCATCCCTTTGCCCACCATCACA AAGTTAATTACTAAGATTTTTGATGATATGTCACATGATGTATGGCACGAGGTTAGACTT TCCACATTGAATGGTATTATGTATTTGTTTGGAAATCCCCAATGTCATCAAATTCTCAAT GTGCTTCTACCCAGATTGGGGCATTTGATGATGGACAATGTCCTATCAATAAGAGTTGCC ATGGCAGATCTTCTTCTTCTTGTAAGAGATATTCGAAATTTCCAGTTCCATAAGGTGGTC AAGTTAGATGTATTGTTATCTACCCTTGCAAATGATCAACCTCAAGTTGCTCAGAAAATC ACAGGACTGCTTATGCCATCATACTTTCCCTCGAAAGTGTCTGTTGAAGCAGCATGCAAT CGCTGTGTGACACTTGTTAAAAGGTCTCCGATGGCTGGAGCAAGGTTTTGTGAGTTTGCT GTGTCCCAAGGGGCATCTCATAAGTCTTTGGTGGAACTTGTTAGAGTATTGGTTACTTTG GTCTTGCTGCCTAATAATCTGGATGAAGATCAAGTTGAGGGTTTACTTCTCGCTGCTGCC AACCTTTGTAATACCCTAGCCAGCGAGCCATTTTTCAAGAATGCTCTTAAAGAGTTCTTT GATGGTGAAAAGCTGAAGTGCTTGTTTGCTGCTGCGGCTACTGGGCGTGCTCAGTCTTCT GTATTCAACATTGTTTCAGCTATCTCTCCAGATGATGTGACTGGACTTCTTGATGAATGC ATGCACCAGGTCACAAATTGTAGTGGTTTATCCACAAATGTGGAGAGGCAAGCTGAAGTG AGGTCTGCTCACAAGTTGTTGCTCTCTTGTGATGGGGTTGATGGCATGCTTGAAGCTCTA ACAGCCTTCCTGCAGAAAGCTGCATACCGTTGCCATATTAAATTTGGCAATGAAATACCG AAGCTGAGTGTTTTCTCTGCAAAAAGGAAGAAATCGAAGTCCTCTAGCAAAATTTCAGCT CGATGGAAAAACGTTGGTGGGAAAAAGCAAACCAATTTTGAGAATGATTATTCAATTGCA GTAGGAATAGCCTGGCAAATTAGAGACTTGCTTGTATCTGTCAACACTCGGAAATCTATA TTGGGATCTCAAGTTCTAGAATCGCTATTTCTATCCTTAAAGGTCTTGTCTGAGGTCAGC GTTGTGCAGTGCATGCATTGTGAATATATGGACACATCTCCGGTTTTGGCATATACAGAT CTTGCTCTGCATATGTCTCTTCAAAAGGATCATAGGACTGAATCCACAAGGTCTAGTTTG GAGGCAAGTGCTATGTCTCTCAGCTGTTTTTCTGCTCATATCTTAATGCTGAACATATCA AAACCAGAGTTTCTCTCACACGTGATACTGCTATTTGGAGCAGGTGATTCTGGAGGGTCT GGAAATATTTCTCCAGAATCTAAGCATGCTAGCAATAAGTCGTCCACTCGTCGTGAAAAA AGACACAGAGGACCTCAGATTGATGCCTCCAGTCCAAGTGATGGTGGATGTGTCTATACT GAACCAAAGAAGTTATCAAACAAGGTGAAGATGCTTACTGCAGTCCTAAGGTTCGTGGTT GATGCTGCTACAATAGGTTTTGTTCCTCAAAATCAGAGCAGGTGCTTAAAGTTCACATCA GGTTATATACAATGCGTCACATCTACTTTGGAGCGACAATCTCGGGAGCAGTTTCAATTT GAGGAGGAGGAGGATTTGAAGGATATGATTCTCTGTCTGAAGAGCTCCTTCACCTATGCA GCCAAGTTACTTAATCTAGCTCTTAAAGATGTTACAGAAGCTTCACTACTTCTCACAGAA GCTTCTGATCTTGCGAACTATCTGCTTGACTTAATCATCTCGATTGAATTGTACTTGGGC TCTAACTACGTTGCGCATATGGTGACAGGAGTAAAGTCTTGGCTTCCTGACTTGGTTTTG GCATTAGGATCTGGCCAGATTATGAAACAGATTAAGGGAGAAGCGACAGAAATAACTGCA GCTGATCGCAACAGACTCCACTTTCCATCATGGCTCTTGATTTTAGCAAAGATTGAGGTC TCCGAAATAAGTGAAGTTAGGCCAGAAGAAGGTGGAGATTCTGAACCAGAGGAGTTTCCT GCATTTAAGAAACTTCTGGACATGATTGTCATATTGTTGAAAGGAAACCTCAGCATACGG GATGTTTTTGGAGTGGTTTTCTTGATTGCCGCCATAGTTGGGCTGGAAATGAAGAATTTC AGGTTGGTTTCCGGACTTGTACGCTTTGTATGCCTGAAGGTATTCAGGCAAGATGAGAAA GAGTGGGGTGATATGATGTTGGCTTCTCTTCAAGACCTTTACCCTCAGATAGAGAGAGAA ATGGAAGAAGAAAGCCAAGAAGATGGAAGGGAAAATCTGCGAAGTGCAAAGGAATTGCTT GAACCAATTTGGATGTATCATATCACCATATTTCTCACAGAAGCTTCTGATCTTGCGAAC TATCTGCTTGACTTAATCATCACGATTGAATTGTACTTGGGCTCTAACTACGTTGCGCAT ATGGTGACAGGAGTAAAGTCTTGGCTTCCTGACTTGGTTTTGGCATTAGGATCTGGCCAG ATTATGAAACAGATTAAGGGAGAAGCGACAGAAATAACTGCAGCTGATCGCAACAGACTC CACTTTCCATCATGGCTCTTGATTTTAGCAAAGATTGAGGTCTCCGAAATAAGTGAAGTT AGGCCAGAAGAAGGTGGAGATTCTGAACCAGAGGAGTTTCCTGCATTTAAGAAACTTCTG GACATGATTGTCATATTGTTGAAAGGAAACCTCAGCATACGGGATGTTTTTGGAGTGGTT TTCTTGATTGCCGCCATAGTTGGGCTGGAAATGAAGAATTTCAGGTTGGTTTCCGGACTT GTACGCTTTGTATGCCTGAAGGTATTCAGGCAAGATGAGAAAGAGTGGGGTGATATGATG TTGGCTTCTCTTCAAGACCTTTACCCTCAGATAGAGAGAGAAATGGAAGAAGAAAGCCAA GAAGATGGAAGGGAAAATCTGCGAAGTGCAAAGGAATTGCTTGAACCAATTTGGATGTAT CATATGTATGAAACTGGGAAGGTTTCTATGGAGGAAGACTAG
PEP MEKRLRSALRSSADEFLSSATKQTLKSSKPALKTLIHAINPSSDLSSSLPLSLCNSISQT IQSFQNLLDPNSNPNPKPSSPRSPPTKRLRRSSRRSKTWSEPEPDDPDPNPDRQKQRLLS ELQVLAFITQLCVSHPQNAFSPLDLLAGVQALHDNLIILESDSVLVSEIASLCEQWWKEE LPGRESLISQSLPFLLSRSLTLKKKADVHRVYALREAFACFDFEDDSIEDLKQLLIRCVI SPLYLKTEEGKKFLAFLFGLSSQLLKEVLAMIGSQVPFGRKSMLEAYGDVLFRAWKVLEG DSRSEIENGFLQGLIDGAIHASSGALAASIRRVLGGFINQRTTAGVEKLLFQLSEPVIFR SLQVANSNVRQNALHLILDLFPLEDPDSTKEVKDSLLDKQFFLLERLLADDCPDVRVVAV EGSCRILHLFWEIIPLPTITKLITKIFDDMSHDVWHEVRLSTLNGIMYLFGNPQCHQILN VLLPRLGHLMMDNVLSIRVAMADLLLLVRDIRNFQFHKVVKLDVLLSTLANDQPQVAQKI TGLLMPSYFPSKVSVEAACNRCVTLVKRSPMAGARFCEFAVSQGASHKSLVELVRVLVTL VLLPNNLDEDQVEGLLLAAANLCNTLASEPFFKNALKEFFDGEKLKCLFAAAATGRAQSS VFNIVSAISPDDVTGLLDECMHQVTNCSGLSTNVERQAEVRSAHKLLLSCDGVDGMLEAL TAFLQKAAYRCHIKFGNEIPKLSVFSAKRKKSKSSSKISARWKNVGGKKQTNFENDYSIA VGIAWQIRDLLVSVNTRKSILGSQVLESLFLSLKVLSEVSVVQCMHCEYMDTSPVLAYTD LALHMSLQKDHRTESTRSSLEASAMSLSCFSAHILMLNISKPEFLSHVILLFGAGDSGGS GNISPESKHASNKSSTRREKRHRGPQIDASSPSDGGCVYTEPKKLSNKVKMLTAVLRFVV DAATIGFVPQNQSRCLKFTSGYIQCVTSTLERQSREQFQFEEEEDLKDMILCLKSSFTYA AKLLNLALKDVTEASLLLTEASDLANYLLDLIISIELYLGSNYVAHMVTGVKSWLPDLVL ALGSGQIMKQIKGEATEITAADRNRLHFPSWLLILAKIEVSEISEVRPEEGGDSEPEEFP AFKKLLDMIVILLKGNLSIRDVFGVVFLIAAIVGLEMKNFRLVSGLVRFVCLKVFRQDEK EWGDMMLASLQDLYPQIEREMEEESQEDGRENLRSAKELLEPIWMYHITIFLTEASDLAN YLLDLIITIELYLGSNYVAHMVTGVKSWLPDLVLALGSGQIMKQIKGEATEITAADRNRL HFPSWLLILAKIEVSEISEVRPEEGGDSEPEEFPAFKKLLDMIVILLKGNLSIRDVFGVV FLIAAIVGLEMKNFRLVSGLVRFVCLKVFRQDEKEWGDMMLASLQDLYPQIEREMEEESQ EDGRENLRSAKELLEPIWMYHMYETGKVSMEED


| Top |