Cherry SNP DataBase

Gene information

Gene Pav_sc0005028.1_g010.1.mk
Chromosome name PAV_r1.0chr7
start 6066194
end 6076481
PAV_r1.0 name Pav_sc0005028.1
start 5168
end 15455
direction +
Annotation NR PREDICTED: cytochrome P450 93A3-like
Sequence CDS ATGAAGAAAGCAAGACAAGAAATTGAGCTAATCAACCACCCAGAAGTGATGAAGAAAGCA AGACAAGAAATTGACTCCATAGTTGGCAAAAACAGACTAGTACAAGAATCAGACATTTCC AACCTTCCTTACCTACAAGCCATAATGAAAGAGACCCTAAGGCTTCACCCTACAAGCCCA TTAATTGCCAGAGAGTCAACTGAAGCCTGCAACATTGTTGGCTATGAGATTCCAGCAAAA ACCAGATTGTATGTGAATGTGTGGGCTATCAACAGAGACCCGAACCACTGGGAGAAGCCA TTGGAGTTCGAGCCGGAGAGGTTTATGACTGAAGAGGGAAGTCTGAAAAGCCAGTTAGAT ATGAGGGGACAACATTTTCATATGTTGCCATTTGGTAGTGGAAGAAGAGGGTGCCCTGGA ATCTCACTTGCAGTAGCGGTTGTTCAGCCAACCCTTGCTGCTATGATTCAGTGCTTTGAA TGGAAACTTGAGGGAGGAAATGGTAGTGGTATTGTTGACATGGAAGAGGGACCTGGCTTA ACACTTCCAAGGGCTCATCCCTTAGTTTGTGTTCCAGTGGCTAGGCTCAATCCCTTTTTA TCTTGTTGA
PEP MKKARQEIELINHPEVMKKARQEIDSIVGKNRLVQESDISNLPYLQAIMKETLRLHPTSP LIARESTEACNIVGYEIPAKTRLYVNVWAINRDPNHWEKPLEFEPERFMTEEGSLKSQLD MRGQHFHMLPFGSGRRGCPGISLAVAVVQPTLAAMIQCFEWKLEGGNGSGIVDMEEGPGL TLPRAHPLVCVPVARLNPFLSC


| Top |