Cherry SNP DataBase

Gene information

Gene Pav_sc0005174.1_g020.1.mk
Chromosome name PAV_r1.0chr6
start 13499024
end 13504277
PAV_r1.0 name Pav_sc0005174.1
start 6417
end 11670
direction +
Annotation NR PREDICTED: uncharacterized protein LOC103332799 isoform X1
Sequence CDS ATGATCTTAAGTTGTAATCCGAACATGGATAAAGTGTCTTCTGACTGTCCATACCCAGGA TGCTTCTTTTGTGTCATGAAGGAAGGGAATCCAAGCAAGCGAAGAGCAAGCATTCTGAAG TTCTTTAGAGAGCTTCCTGCACAGGATGACGATGGACAAGTTCTCCCTATCAGTGGCCTT TGGAACACTGCCATGGCACATCCAAATGATCCTGAGTTCATCGAGCTTGGCATCTTTGAA TGTATGGCTGCATTAATATGGAAGGGTCTAAAGAATCGTCGCTGGCTTTCTCATGACCAG AATATATACATTCCTTATTATGCAGCCCATATTATTGGGTCATACACCATGAACATGGAA GAATTTGCAGAAAGTGCTGTGCATGCTGGGGTAATCCCTCCCTTAGTTGAACTTTTGAGA GGAAGGTTAACTTGGGTTGAACAGAGAGTTGCAGTTCGAGCTTTAGGGCACTTGGCTACC TATGCCAGCACTTTTCCTGCTGTAGCAAGTCATGGTGAAATTCTTGAGCTTTCCATTCAA CTAGCAATGAGCTCACTAGAAATCGTTTATTCTCATTTTTACCAGTATGTTGACAGAAGG TTAAGCTATCATTGCGATCTGCTCACCCGCGGTATGGGAGGTGTTGAAATGGAGTCCAGA AAGGCAGAAGAATGGGCAAGTCAGTTACAATGCTGGTCCCTCCAGCTTATTAACTGCTTT GCCTTTAAACCAGAGTTTCTTCCTACCATATGCAAGCCTGAATTCTTAACAAAACTACCT GGCATGTGGGGTGGGCTTGTTAATGAAAACTCACCAGCTGGTATTGGTTTATTAAGAACA ATCTGCCATCATAAGTTGGGTAGAGGACCTGTTGCTAGCTGTCCTGGTATTATCGAATCA TTGTGTAATATTGCTCGGTCATCAGATGATTGGCAGTATATGACTATTGATTGTCTTCTT TGGTTGCTTCAAGACCCTAGTACATGTCATAAGGTGATTGATAAGGCTGTACCTGCACTT GTTGACCTTGCGGAGATTACAACTCTGGGTGATCACAAGAAGCTTGGAGATTCCATTGTT AATGTTCTTGAGGAATGTGTCCAGTCACAAGGGACAGGACGCAACTCTTTCAATAACCGA ACGAAGGAATTGATTGAGGAACTGTTGAATTCCAGACAGAGATTGAAATGGGAAAAGAAT ATGCCTAAAGAGGATCTCCATATTAAACAGGCAGCAGCTCTAGTGGTCAAGCTTGAAGGA AATTCATTATTTTCATCAGGAAATATATCTGGAGCTGCATCAAAGTACTCAGAAGCGTTG GCATTGTGTCCAATGAGATCCAAAAAGGAGAGAGTTGTTCTTTACAGTAATCGAGCACAG TGTCATCTTCTGTTGCAACAGCCCTTGGCAGCTATTAGTGATGCTACTCGTGCACTTTGT CTTCACAACCCACTGAACCGTCATGCCAAAAGTCTTTGGAGAAGAGCACAGGCTTATGAC ATGCTTGGGCTTGCAAAAGAGAGTTTGTTAGATGCCATTCTGTTCATAAACGAGTGCTCT CAGTCAAATGATCCTGATCTCTCGTTGAGGCAAAATAAGGTTCCTGACTATGCGGAACGA TTGGTTAAAAAGCAGATGCGTGCAGCTTGGTTATTTAGAGAGGCAGCTATCAAACATGGG GGTGTCCACTGTGAGGGTGATGCTGGTGACATCTATGGCCGAGAGACCGATGATTCCGAA TGGGAGACAGCAAGTGAGAGCGATATAGGAAATGATGGAAGAGATGAAATGGGCAATGAT GATGATGATGATGAGGATGATGATGATAGTGAATGGAAGAAAGATGATAGTGAATGGAAG AATGATGATCGTGAATGGAAGAATGATGATGAGAGGAAAGAGAAATATGATAAGTCTTCA ATGAAAGACCTAAAGCATGGATACAATGTGCAGCTTGCGGAAGATGAGCCATGA
PEP MILSCNPNMDKVSSDCPYPGCFFCVMKEGNPSKRRASILKFFRELPAQDDDGQVLPISGL WNTAMAHPNDPEFIELGIFECMAALIWKGLKNRRWLSHDQNIYIPYYAAHIIGSYTMNME EFAESAVHAGVIPPLVELLRGRLTWVEQRVAVRALGHLATYASTFPAVASHGEILELSIQ LAMSSLEIVYSHFYQYVDRRLSYHCDLLTRGMGGVEMESRKAEEWASQLQCWSLQLINCF AFKPEFLPTICKPEFLTKLPGMWGGLVNENSPAGIGLLRTICHHKLGRGPVASCPGIIES LCNIARSSDDWQYMTIDCLLWLLQDPSTCHKVIDKAVPALVDLAEITTLGDHKKLGDSIV NVLEECVQSQGTGRNSFNNRTKELIEELLNSRQRLKWEKNMPKEDLHIKQAAALVVKLEG NSLFSSGNISGAASKYSEALALCPMRSKKERVVLYSNRAQCHLLLQQPLAAISDATRALC LHNPLNRHAKSLWRRAQAYDMLGLAKESLLDAILFINECSQSNDPDLSLRQNKVPDYAER LVKKQMRAAWLFREAAIKHGGVHCEGDAGDIYGRETDDSEWETASESDIGNDGRDEMGND DDDDEDDDDSEWKKDDSEWKNDDREWKNDDERKEKYDKSSMKDLKHGYNVQLAEDEP


| Top |