Cherry SNP DataBase

Gene information

Gene Pav_sc0005248.1_g040.1.mk
Chromosome name PAV_r1.0chr8
start 9736487
end 9753127
PAV_r1.0 name Pav_sc0005248.1
start 13457
end 30097
direction +
Annotation NR PREDICTED: protein CASP
Sequence CDS ATGGAGGCTCCGCAAGGCGGATCCGACAGAGACAAATCGAGCTCCTCCTCTTCTCCCATC TCCGTCGTCTCCAACTTCTGGAAAGAATTTGATTTGGAGAAGGAAAAAAGTGTACTGGAT GAGCAAGGGCTCAGGATAGCTGAAAATCAAGAAAACAGCCAGAAGAATAGGCGGAAGCTT GCAGAGAGCACTAGAGATTTCAAGAAAGCTGCACCAGAGGAAAAGCTAAATCTTTTTAAC TCTTTACTTAGAGGTTACCAAGAAGAAGTTGATAATCTTACCAAGAGAGCGAAGTTTGGG GAGAATGCTTTTCTTAACATCTATCAAAAACTTTACGAGGCTCCAGATCCTTATCTGGCT CTTGCTTCAAGTGCTGAGCAAGATCTGAAATTGTCTGAATTAGAATCTGAGAATAGGAAA ATGAAAGTTGAGCTTGAAGAATTCAGGACAGAAGCAACTCATTTAAAAAATCAACAGGCA ACAATAAGAAGACTTGAAGACCGCAACCGTCAGTTAGAGCAACAGATGGAGGATAAAGTT AAAGAAATTGTGGAGATCAAGCAACGCAGTTTTGCGGAAGAGAACCAGAAAATGCTTGAG GTCCTAAAAGAAAGAGAGCAATTGTTGCAAGATCAATTACGACAAGCTAAAGACAGTGTT TTCAATATGCAGAAATTACATGAGCTTGCTCAAAGTCAATTGTTCGAGCTTCGTGCTCAA TCTGATGAAGAGAGGGCAACCAAGCAATCCGAGGTCAATCTTCTGATGGATGAAGTTGAA CGGGCCCAGACACGGCTTCTTAGTCTTGAGAGGGAGAAGGGACTTCTGCGCTCCAAATTA GACACAGCAAATGAAGACACTGAAAATAAGAACAGTGATACTTCAGATTCAAATAGCATC CTTGAGAATTCTTTAATTGCCAAAGAGAAGATCATCGCCGAAATCAACATGGAACTGCAC AACATTGAAACAACATTATCAAACGAAAGAGAGGAGCACCTGAATGAGATCAAGAAGTTG AACGCATTGCTCATTGAAAAGGAAGCTGCTCTCGAGGAGATGAAGAAAGAGCTTCAGGCA AGGCCAACAACAAAACTGGTTGATGATTTGCGTAAAAAGGCAGTGGGTTATAATTCAATT GAGGCTGAAGATTGGGAAGTAGCCACAAGCGGGGAAGAGATGAGCAAAATGGAGTCTCTT CTTCTTGATAAAAACCGGAAAATGGAGCATGAACTCACACAGTTGAAAGTCAAACTTTCG GAGAAAGCATTGTTGCTGGAAAAAGCTGATGGCAAGACAGCAGAACTTACAGTAAAGGTT AATGAACAACAAAAGTTAATCCAAAAGTTGGAGGATGACATACTGAAGGGCTATAGTTCC AAGGATAAGAAGGGAATCCTATTTGATGACTGGGATCTTTCAGAGGCTAGGAGTACTGAG GTGTCTGAGAATGCAGATCAAAAGCACATTTCCTCGGACCAAGACCAAAGCTCAATGCTT AAGGTTATCTGTAACCAGCGAGATCGATTCAGGACACGCTTGAGAGAGACAGAAGAAGTC AAACTTTCTGAGAAAGCATTGTTGCTGGAAAAAGCTGATGGCAAGACAGCAGAACTTACA GTAAAGGTTAATGAACAACAAAAGTTAATCCAAAAGTTGGAGGATGACATACTGAAGGGC TATAGTTCCAAGGATAAGAAGGGAATCCTATTTGATGACTGGGATCTTTCAGAGGCTAGG AGTACTGAGGTGTCTGAGAATGCAGATCAAAAGCACATTTCCTCGGACCAAGACCAAAGC TCAATGCTTAAGGTTATCTGTAACCAGCGAGATCGATTCAGGACACGCTTGAGAGAGACA GAAGAAGAAATAAGGCAGTTGAAGGAAAGGATAGGAGCGTTAACAGCAGAACTGGAAAAG ACAAAAGCTGATAATGTTAAACTCTATGGAAAGATTCGTTATGTTCAGGATTACAGTCTT GAAAAAGTAGTTTCTAGAGGATCAAAAAAGCCTGCAGAGGATCTTGAAGGTGGTTTCTCC TCAGATGTTGAATCCAAATACAAGAAGATATATGAGGATGACATAAATCCTTTTGCAGCC TTCTCGAAAAAGGAAAGGGATCAAAGGTACAAGGAGTTGGGTTTCAGGGATAGAATTACA CTTAGCAGCGGACGTTTTCTTCTTGGCAACAACAATGGTCAGGAGGATGTAATTATTGGC GATAAACAAGAAATAAGGCAGTTGAAGGAAAGGATAGGAGCGTTAACAGCAGAACTGGAA AAGACAAAAGCTGATAATGTTAAACTCTATGGAAAGATTCGTTATGTTCAGGATTACAGT CTTGAAAAAGTAGTTTCTAGAGGATCAAAAAAGCCTGCAGAGGATCTTGAAGGTGGTTTC TCCTCAGATGTTGAATCCAAATACAAGAAGATATATGAGGATGACATAAATCCTTTTGCA GCCTTCTCGAAAAAGGAAAGGGATCAAAGGTACAAGGAGTTGGGTTTCAGGGATAGAATT ACACTTAGCAGCGGACGTTTTCTTCTTGGCAACAAAAAAGAGAAAGAGAGAGGGGTTAAA CGACAACCAACTTCCCCACATGATGAAGAAAATGATGATGGTTCAGAGTCTGAACAAGAG AGATTGCGTGATCAAAGAGAAAGGGAGCAATTGGACCGTAATATAAGGGAGCGGGACGCA GCAGCAACGCGAAAGCTATCAGAGCAAAAGCAGGCTTTTGCTACTCGGAGAAGCAATATT GTTGGCGACGTTGAAACTTTAAGAAAAGTTTCAAGACAAGAATATTTAAAGAAAAGGGAG GCAAATAAATTGAAGGAGCTTGGAGAATCTATAGAAGATGAGGAGTACTTGTATAAAGAC GTTAAGCGTACTGAAGCGGAATACAATCGATTAAGTTACGAGAAGAAAATATATGAGCTT GCGACGAAGCATGAGGCTGCTACTCATCATGATCATGATCAGTACTACAGGATTCCGGAA CCCCATGACGATCATGAGGGCGGTGTTAATCAGGAGAAGCGATTCTCGGTGGGTTTACAA CGTTGCTGGGATGATGATCTGAATGCCAGGGATAAAAAATCAAACCCTTTTGCTGAACAG AAAGCTTGGGAGGATCAGCAAATTGGGAAGGCAACATTGAAGTTTGGTTCGAAAAACAAA AGGCGGAAATGTGATGACGAGTATGATTTTGTATTTGAAGACCAGATTGAATTTGTCAAG GCGTCGAAGAACGGGTGTTATAGAACAATCAAACATCCGCACACTGCCCATATACACCCC AGCTCAGGGACTATGAGAACAATCAAACATCCGCACACTGCCCATATACACCCCAGCTCA GGGACTATGGCATTGGAACATCACGTGCTTCCTAGATGTGTTTTGTACCATGAACTGGTA CTTACTACCAAGGAATATATGAGACAGGTCACAGAGATAAAGCCGGAATGGTTGGTTGAA ATAGCTCCACATTATTACCAGTTGAACGGCGTCGTTGAGGAGGATTACTCAACTTCGAAG AAGATGCCTCGTGGAAAAGGGCGTACAAGCACTTCAAAGCAAATTCCTAATCTTGTTGAT TACAGCATATGTGTATAA
PEP MEAPQGGSDRDKSSSSSSPISVVSNFWKEFDLEKEKSVLDEQGLRIAENQENSQKNRRKL AESTRDFKKAAPEEKLNLFNSLLRGYQEEVDNLTKRAKFGENAFLNIYQKLYEAPDPYLA LASSAEQDLKLSELESENRKMKVELEEFRTEATHLKNQQATIRRLEDRNRQLEQQMEDKV KEIVEIKQRSFAEENQKMLEVLKEREQLLQDQLRQAKDSVFNMQKLHELAQSQLFELRAQ SDEERATKQSEVNLLMDEVERAQTRLLSLEREKGLLRSKLDTANEDTENKNSDTSDSNSI LENSLIAKEKIIAEINMELHNIETTLSNEREEHLNEIKKLNALLIEKEAALEEMKKELQA RPTTKLVDDLRKKAVGYNSIEAEDWEVATSGEEMSKMESLLLDKNRKMEHELTQLKVKLS EKALLLEKADGKTAELTVKVNEQQKLIQKLEDDILKGYSSKDKKGILFDDWDLSEARSTE VSENADQKHISSDQDQSSMLKVICNQRDRFRTRLRETEEVKLSEKALLLEKADGKTAELT VKVNEQQKLIQKLEDDILKGYSSKDKKGILFDDWDLSEARSTEVSENADQKHISSDQDQS SMLKVICNQRDRFRTRLRETEEEIRQLKERIGALTAELEKTKADNVKLYGKIRYVQDYSL EKVVSRGSKKPAEDLEGGFSSDVESKYKKIYEDDINPFAAFSKKERDQRYKELGFRDRIT LSSGRFLLGNNNGQEDVIIGDKQEIRQLKERIGALTAELEKTKADNVKLYGKIRYVQDYS LEKVVSRGSKKPAEDLEGGFSSDVESKYKKIYEDDINPFAAFSKKERDQRYKELGFRDRI TLSSGRFLLGNKKEKERGVKRQPTSPHDEENDDGSESEQERLRDQREREQLDRNIRERDA AATRKLSEQKQAFATRRSNIVGDVETLRKVSRQEYLKKREANKLKELGESIEDEEYLYKD VKRTEAEYNRLSYEKKIYELATKHEAATHHDHDQYYRIPEPHDDHEGGVNQEKRFSVGLQ RCWDDDLNARDKKSNPFAEQKAWEDQQIGKATLKFGSKNKRRKCDDEYDFVFEDQIEFVK ASKNGCYRTIKHPHTAHIHPSSGTMRTIKHPHTAHIHPSSGTMALEHHVLPRCVLYHELV LTTKEYMRQVTEIKPEWLVEIAPHYYQLNGVVEEDYSTSKKMPRGKGRTSTSKQIPNLVD YSICV


| Top |