Cherry SNP DataBase

Gene information

Gene Pav_sc0005323.1_g030.1.mk
Chromosome name PAV_r1.0chr1
start 16454777
end 16467906
PAV_r1.0 name Pav_sc0005323.1
start 41538
end 54667
direction +
Annotation NR PREDICTED: something about silencing protein 10 isoform X1
Sequence CDS ATGGGCAAGAGAGGAAAGAGTCAGAAGAAAGTCGATGGAAAGCCTAATAAGAGAAAGCTC CGTGATGAAAATGGTGTCATTGAAGATGACATGGACGACGAAATTGATTCATTTCACAAA CAAAGAGATGTTGTTCCTCTGGACATTAATGAAGAGGCTGAGGATTCCGATGAAGATAAC GAGCAACCTGTCTTTGACTTTGAGAATATTAATGATGGCGACGATGATGACACCCATGAT ACTGGATTTGCAGCAAAAATTGTTAGGCAGCAAAAGTTTTTAACGGCAAAGTTTGGTGGA GTTGAGGATGAAATGCATGATGATGATGAAGAGGATGAGGAAGATCAAAACCCTGTATGG GGAGGAAGGAAGCAGCAATATTATGATGCTGATAATCGTGATTTTGAGCAACAATCAAGT GGCGATGAGTCTGCGAAAGAGGAAGAGGCAGAAGTGCTGAGGCTGCAAAGAGAAAGGGCA AAATCAGCAATGTGGGAAGACTTTGGCCTTGAGGATATTTGTCAAAATGAGAGTGATGCC GAATTAACTTTTGAGGAAATTTCACGTAAGGGAAAAAGTACAAAGAAGTCTCCAATGGGA ATTGAAGTTTCAGATGACATGGGTACAGCTTATGAGGAGGTGAAGAAAGACTTGAATTCT TTGTCAAAGGAGGAGAAAATGGATGTTTTATATAGTTCCGCTCCAGAATTAATTGGGTTG TTGTCAGAGCTGAATGATGCACTTGAAGAGCTTCAAAGCAGAGTTAATCCACTTTTAAGC AAGGTTAAAAATGGGGAGGTCATGTTGGAAGGAGGGATGCGCTATTTAGAGGTAAAGCAG CTTCTTCTGCTGGCCTATTGTCAAGCCATAACGTTCTACCTTCTTCTCAAGTCTGAAGGC CAACAAGTTCGTGATCATCCTGTTCTTGCTCGCCTAATAGAGATCAAGAGTTTGTTGGAT AAGAAGGTTGTCTCAGGTGATGATGATTTACCTCAGAGAGATGATATTGGGGAGAGGCGG AGAAAGCATGAGCTCCGAGTACTGGCAGGAGCTGGAATCAAGTCTGATGGTGATGCTGGA GATGAAAATGGCGCTATTTCGGATGATGGAGATGTTGAGATGGATGATAGTGGAACTGGA GATTCAGAAGATGAATTTTACGAACAAGTGAAAGAAAAACGAGCTGCAAAACTTGCTGCC AAAGCTCAGATTTATTCAAGGTCCTCTACAGTTCCATCTTTGGTCGAAACTGAATCTGTC GATGGGAAACGCCACATTACTTATCAGATGGAGAAGAACAGAGGACTTACTCGTGCTCGC AAGAAGCTGATCAAGAATCCAAGAAAGAAGTACAAGTTGAAGCACCAGAAAGCACAAGAG CGTAGAAAAGGACAGGTAAGAGAAGTCAAGAAGCCTATTGAACCAATCAGCCTCGTCCGC ATCAGGATCTGGTTCAGTGCTGGGTGGCCATCTGGCTTCTTAAGAAAAGTAGGCAGGTCA GGAAAGTTGAGTGGAGGCAGGCCAGGAACCAACAAGGGCATGTCTTCCAACTCAAATGGA AGATATGCTGCACACCATGGCCGAATTGCCGCAAGGAGTGAGAAGCATCATTTCTTCAAA GCAAATCCATCTTCGTTTTTCAAAGCATCATCGGTCTTTCTTCCTTATACTATGGCTTTG AGAGGTGCGTGGCAATTGCAAAAGCTGATTGTGAGCTTTTCTGATTGGGGAGGAAGCAGT AGGGGAATCAGGTCATTTATGGAGTCATATTTACCAGTATTTAAAGAGAAGAATCCTCAG CTGGAGGTGGTTACTGAACTCATCCGGGGTCAGCATCCACATTTGAAGGGCTTTTACAAG AACAAAAGTGAGAGGGTGGTATGTGTGAAGAATATGGATCCAGAAGAGGTTCTTCAATAT GCAACCAGGCTAAGAAATTCACTGGGGAGAAAAGTGGTGAAACTGAAGACTAGACATGTA ACCAAACATCCTAGCGTGCAAGGTACCTGGACAACAGACGTGAAATTTTGA
PEP MGKRGKSQKKVDGKPNKRKLRDENGVIEDDMDDEIDSFHKQRDVVPLDINEEAEDSDEDN EQPVFDFENINDGDDDDTHDTGFAAKIVRQQKFLTAKFGGVEDEMHDDDEEDEEDQNPVW GGRKQQYYDADNRDFEQQSSGDESAKEEEAEVLRLQRERAKSAMWEDFGLEDICQNESDA ELTFEEISRKGKSTKKSPMGIEVSDDMGTAYEEVKKDLNSLSKEEKMDVLYSSAPELIGL LSELNDALEELQSRVNPLLSKVKNGEVMLEGGMRYLEVKQLLLLAYCQAITFYLLLKSEG QQVRDHPVLARLIEIKSLLDKKVVSGDDDLPQRDDIGERRRKHELRVLAGAGIKSDGDAG DENGAISDDGDVEMDDSGTGDSEDEFYEQVKEKRAAKLAAKAQIYSRSSTVPSLVETESV DGKRHITYQMEKNRGLTRARKKLIKNPRKKYKLKHQKAQERRKGQVREVKKPIEPISLVR IRIWFSAGWPSGFLRKVGRSGKLSGGRPGTNKGMSSNSNGRYAAHHGRIAARSEKHHFFK ANPSSFFKASSVFLPYTMALRGAWQLQKLIVSFSDWGGSSRGIRSFMESYLPVFKEKNPQ LEVVTELIRGQHPHLKGFYKNKSERVVCVKNMDPEEVLQYATRLRNSLGRKVVKLKTRHV TKHPSVQGTWTTDVKF


| Top |