Cherry SNP DataBase

Gene information

Gene Pav_sc0005746.1_g130.1.mk
Chromosome name PAV_r1.0chr2
start 21654294
end 21659758
PAV_r1.0 name Pav_sc0005746.1
start 55661
end 61125
direction -
Annotation NR PREDICTED: uncharacterized protein LOC103333071
Sequence CDS ATGGAAGATATTCAAGAGGAACTTTTACCTTGCTCCTCTTTCCCTTCACATAATCCAAAG GCGTTGTCAATTGATGTGGAACTCTGGATGATGGCTGAGGAAAGGACCCAAGAGATCCTT TGGACTATACAACCAAATGTAGGTTCTGAGTGGAGGCGGAGGGGGCTTATTAGTTATATT CAGAGGCTTATCAAAGGTCATTTTGGAACTGAGGTCTTCTCCTTTGGCTCAGTCCCACTA AAGACCTATCTTCCTGATGGAGATATTGATTTGACTGCCATCTGCCATCAAAACGCGGAG GAGGAATTAGCTATAGCTGTCTGCGGTGTCCTTGAAAGTCAACGGAAGGACTCCTTGTTT CAATTTAAAGATGTCCGTTATGTTCGGGCACAGGTTAAGGTTGTAAAGTTCACAGTGAAT AACATAGCAGTGGACATCTCCTTCAATCAAATGGCTGGGCTTTGTACACTGTGCTTTCTG GAGCAGGTCAACCAACAGATCGGAAAAGACCATCTTTTTAAAAAGAGTATAATCTTAATC AAAGCTTGGTGCTACTATGAGAGCCGGATTCTTGGATCCCATTATGGTTTGATTTCAACA TATGCACTAGAAACGTTGGTGTTGTTTATCATCAATCTGTTTCATGCATCACTTCGTGGT CCTTTAGAGGTCCTGCAGAGATTTTTGGAATACTATAGCACCTTTGATTGGGACAATTAT TGTATCAGTATAAATGGTCCAGTTGCGATATGTTCCCTTCCGGAAATCATAGTGGCACCC CAAATTGAGGCAGACGAATTACTGCTCAGTGAGGAGTTTGTGAGAAGCTCTAGAGATGTT TTTTCAGATCCAATAAGGGCAGACGAAGCTACAGTTCATGAATTCCCAACTAAGCACCTC AACATAGTGGATCCTCTAAAAGACGACAACAATCTGGGCCGTAGTGTTAGTAAAGGAAAC TTCTATCGTATAAAATCTGCTCTTTCCATGGGAGCTCAAAATCTTAGAGAGATATTAAAG CTACCGGGTGAAAGCATGGGTGCAGAACTTGAAAAATTCTTCGTGACCACTATAGATAGG AATGGGAGAGGAGAAAGGCCAGATGTGAATGCTCCTGTCTGTGCATTTGGTATTGGAAAA TCTGAAGAATCTGACCTCTGGGGGGAGTATGACAGTTATTATAGTAGCATGTTGTATGGA CAGGCATTTCATCGTTCTACACACCACAGTGCTCCACCTTCTGGAGTCTGTAATAAGACC ACATGGAATGCCCTGGCTTGGTCAGCGCAGCTCAACTGGAATGAATTTTGTGAAAGGGCA ACAAAAGTATATGCAAGACTGCCACTCCGGCATCCTAGTGCGTCCCATCCATCTGCTGAT ACTATAGGTGTTGGGATAACAAGGAAATCACAAGGAACGGGCACATTTATACCTGACGTG ACCCAAAATTATTCCAGATATGTGCGTCCAAGGATGAGGAGGGGAAGGATTCGAGAGTCT AGCAGTCACGATGCAATGATGAAATCACCTCAAAACAGTGGCCAAGTTGAGGCTTCCACA GAAACAGACACAAGTGAAAATGATAGCCGCTTCAATCTTTCACCTGAAGAATTCCCACTT CTTCCTGGCACTGAAAATGGGTCACCAGAGGTCCATCAATCTGGTCATCTCGTCTTGGCG TCTCCTCCAACCAAGGAACCCTCTCACAAGTTGGGGAGTTCTGGGCATTCACCATCACTA TCAGGAATGCCTTCACCTGTAGCGAGCCAGCAGGCAAATACTCATGTTTCATATGCTCTG TACATTTTGAAGAAGCAACAAGAATTATCAGAGGTCAATGAAGAGACGATTCGCATGCAG CAATTCAAACTGGACGATGATGAGGACTTTCCCCCCTTGAATCTGTGA
PEP MEDIQEELLPCSSFPSHNPKALSIDVELWMMAEERTQEILWTIQPNVGSEWRRRGLISYI QRLIKGHFGTEVFSFGSVPLKTYLPDGDIDLTAICHQNAEEELAIAVCGVLESQRKDSLF QFKDVRYVRAQVKVVKFTVNNIAVDISFNQMAGLCTLCFLEQVNQQIGKDHLFKKSIILI KAWCYYESRILGSHYGLISTYALETLVLFIINLFHASLRGPLEVLQRFLEYYSTFDWDNY CISINGPVAICSLPEIIVAPQIEADELLLSEEFVRSSRDVFSDPIRADEATVHEFPTKHL NIVDPLKDDNNLGRSVSKGNFYRIKSALSMGAQNLREILKLPGESMGAELEKFFVTTIDR NGRGERPDVNAPVCAFGIGKSEESDLWGEYDSYYSSMLYGQAFHRSTHHSAPPSGVCNKT TWNALAWSAQLNWNEFCERATKVYARLPLRHPSASHPSADTIGVGITRKSQGTGTFIPDV TQNYSRYVRPRMRRGRIRESSSHDAMMKSPQNSGQVEASTETDTSENDSRFNLSPEEFPL LPGTENGSPEVHQSGHLVLASPPTKEPSHKLGSSGHSPSLSGMPSPVASQQANTHVSYAL YILKKQQELSEVNEETIRMQQFKLDDDEDFPPLNL


| Top |