Cherry SNP DataBase

Gene information

Gene Pav_sc0005787.1_g040.1.mk
Chromosome name PAV_r1.0chr4
start 26133757
end 26139855
PAV_r1.0 name Pav_sc0005787.1
start 26299
end 32397
direction +
Annotation NR PREDICTED: pentatricopeptide repeat-containing protein At5g47360-like
Sequence CDS ATGTCCTCCTCAGTTGGCCGCAAAAGTCACAAATTCTCAATCTTGCGGTTCTCTGCTGCC TCAGATGGGGAGATAGTCTACAATCGGCTGCAGGAAAATGGTGGCAACATTGAGAAAACC CTTTCATCAATCAATGTCCACTTGGACTCCAAATGTGTAAGTCAGGTCTTAAAGAGATGC TATCGTAGCCAATCCCAAATGGGTCTTAGGTTTTTCATATGGGCTGGTCTTCACTCCAGT TATAGGCATAGCTATTTAATGTACAGCAAAGCTTGTGAACTGTGTGAGATTAAGCTAAAC CCAAGTGTGATTTTTGATGTTTTGGAAGCTTATAGAATTGAAGGGCGCTTTGTTAGTCTT AAGGCATTTAAGGTTGTCTTTAATTTATGTAAAGAAGCTAAGCTTGCCGATGAAGCTTTG AGGGTATTAAGGAAAATACCGGATTTTGGTTTGCGTCCAGATACTACTGTGTATAATGTT GTTATAAGGTTGTTTTGCGATAAAGGTGATATGAATACGGCTGAAAGTTTGGTGAAAGAG ATGGGCTTGGTGGATCTTTTGCCCGATTTGATCACGTACATGGTAATGATTAAGGGGTTT TGTAAGGTGGGTCGGTTAGATGATGCTTGTGGGTTGTTTAAGGTTATGAAGGGACATGGT TGTTTGCCTAATGCTGTGGTGTACTCAGCACTTCTTGATGGGTTTTGTAGGTCTGAGAAA ATGGAGAGAGCTTTGGAGTTATTGACAGAGATGGAGAAGGAAGGTGGGGATTGTAGCCCT AATGTAGTAACATATACGTCTGTGATTCAAAAGCTTTGTGACAAGGGTCGGTTGAAAGAG GCGTTGGTTATTTTGGACCGAATGGAAGCTTGTGGATGTGCCCCAAGTCGCGTAACGGTT AGTGCTCTAATTAAGAGTTTTTGTATGGAGGATCAAGTTGAAGAGGCTTATAAACTGATT GATAGAGTTGTTGTGGGACGCAGTGTTACATATAGTGATTGCTATAGCTCTCTTGTTGTG TCTTTGGCAAGAGGTAGAAAACCTGAAGAGGCAGAGAAGGTCTTGAGGATGATGCTTGAT AGTGGAGTGAAACCAAATAGTTTGGCGTGTAGCATTATGTTAAAAAAGATTTGTTTGGAA GGACGGGTGATAGATGGATTTTGCTTGTTTGATGAACTTGAGAAGATGGAATGCTTGTCT TCCATTGACTCTGATACTTACTCAATTCTTTTAGTGGGCCTTTGTGAACAAAAGCATTTA GTGGAGGCGGCAAAGCTGGCAAGGCTAATGCTAAAGAAAGAAATTAAGCTGAAAGCTCCT TATGTTGACAGTATAGCTGAGATCCTGAAGAAATCCGGAGATGAGGAGTTAGTCAAGCAT TGCCACGGAAGTAACCATCTGGTGATTCCTACAAGAGATTACTGCTTTGCACCATCACTG AGTGATACATGTTGTGCTGTAGACTTCATTCATGTTCATTTGTTAATGGTGGATTCGGAA AATGCTGTGAAGGAGAACACTGAAGATTTACGGAAGGCAACTGAACCAGGGGCTGAGGTT GTACGGGAACCAGCTGTGGGAGAAAATAAGACAAATGCTGATACGTTAACATACCAGCAT TTGAGAGACAAAGACGGGAATCCCAAAACACCTGAGAATGTGATGAAGGATTTGGGTGGT GAAGAAAGCCAAACCCATTTGCCTTTCGAGGACTGGAAATGTAGAACTTCAGTCTCCACC GGACACAGCACCACCATCAAGTCCAAATACCGGCAGAGTGAACTGTGGGAGGGATTTCCA CACAAAAAGGGCCCATATTATCCTCCGTTACGTTCAACCACAATACTTCACACACCGATC ATCATGGAGGCTTCAAGTCCTTCTGCTTCGTCCAGAAAAAGAAAAACAAGACAAGCCCCC ATGCCACAAATTGTCCTTGCTCTCGCTGCTCCCAATAGCAACCCCGCCAACAACAATGCC ATCGAACGCACCGTTTGGTCCACCAAACCCCGAAGTAATTGCAGCGGCCGGAGGAGAAAA CAAGAGGCGGCGGCAGCCCAGCAAGAACATGAACGCCAACTCCATATTCCCACCACCAAA CGCACCGTTTCATCCACTAAAATCCAAAGCAATTACAGCCTAAGACCAACAGCACGCGGA GGCCAGAAGACAGCGCCACAAGAACAAGAACATGAAGAAAAGAAGGGAAGGTTGAAGGTG GTTCGGATCCGGGTTTTGGACCCGTATGAAACGGAGTCTTCTACAGACACCGGAGAAACT AATGTAGCCGTTAACAAACAACCCAAGAAAAAGAAATTTGAAATAGTGCACGAGATTCGG ATGCTGGAGAGAAACCCTCCTTGTCCAAAAAACCTTGAGACGCAAGAAACAAGCAAGAAA AGAGAGAGCAAGAAGAACTATATTGGCAAGAATAATAAGCAAATTTGTTTGTCATCTCGA TCATCATCGCCATCTTGTAACGTTGAAGGGCGTGAAGATGAAGAAATACTAAAAGGATCA TCAACAACATCATCAGTTGTGCAAATGGCAGTTAGAAAGATGGCTCTTTACAACGTGCCG GGTCCAATTCCTGACCTGGATGAATTTTTGAAATGGGATTATGACCTTCACTTTTTGCTT ACTTTCTTTGATGATATGCCGTCAGACTCCGACTGTGAAGATTATTGA
PEP MSSSVGRKSHKFSILRFSAASDGEIVYNRLQENGGNIEKTLSSINVHLDSKCVSQVLKRC YRSQSQMGLRFFIWAGLHSSYRHSYLMYSKACELCEIKLNPSVIFDVLEAYRIEGRFVSL KAFKVVFNLCKEAKLADEALRVLRKIPDFGLRPDTTVYNVVIRLFCDKGDMNTAESLVKE MGLVDLLPDLITYMVMIKGFCKVGRLDDACGLFKVMKGHGCLPNAVVYSALLDGFCRSEK MERALELLTEMEKEGGDCSPNVVTYTSVIQKLCDKGRLKEALVILDRMEACGCAPSRVTV SALIKSFCMEDQVEEAYKLIDRVVVGRSVTYSDCYSSLVVSLARGRKPEEAEKVLRMMLD SGVKPNSLACSIMLKKICLEGRVIDGFCLFDELEKMECLSSIDSDTYSILLVGLCEQKHL VEAAKLARLMLKKEIKLKAPYVDSIAEILKKSGDEELVKHCHGSNHLVIPTRDYCFAPSL SDTCCAVDFIHVHLLMVDSENAVKENTEDLRKATEPGAEVVREPAVGENKTNADTLTYQH LRDKDGNPKTPENVMKDLGGEESQTHLPFEDWKCRTSVSTGHSTTIKSKYRQSELWEGFP HKKGPYYPPLRSTTILHTPIIMEASSPSASSRKRKTRQAPMPQIVLALAAPNSNPANNNA IERTVWSTKPRSNCSGRRRKQEAAAAQQEHERQLHIPTTKRTVSSTKIQSNYSLRPTARG GQKTAPQEQEHEEKKGRLKVVRIRVLDPYETESSTDTGETNVAVNKQPKKKKFEIVHEIR MLERNPPCPKNLETQETSKKRESKKNYIGKNNKQICLSSRSSSPSCNVEGREDEEILKGS STTSSVVQMAVRKMALYNVPGPIPDLDEFLKWDYDLHFLLTFFDDMPSDSDCEDY


| Top |