Cherry SNP DataBase

Gene information

Gene Pav_sc0005984.1_g060.1.mk
Chromosome name PAV_r1.0chr4
start 13529868
end 13536420
PAV_r1.0 name Pav_sc0005984.1
start 34801
end 41353
direction -
Annotation NR PREDICTED: uncharacterized protein LOC103326194 isoform X1
Sequence CDS GGAGAGAAGGCAACAGCTGAATGTGTTGCAGATGCCATTGCTGATAATCGAGCTGAGTTG GTTCACCTTCCATCCTCCATAAATCTTCATGCGCCATTACCATCTAAAGACTGCCCGACC TGTGATGGCACGGGTGTGGTGGGCTGTCATGAATGCAAGGACAAATTACAAGTCAGAATC TCTGCAGATGATATCATGGAGCCTCCGTGGAAAGCCTACAATCATATAGTTCACAGCATG AAAGATCCCAGCATCGCTGCATTTTGGCTGTTTACCTTGCCTCAAGTTGCAGGTGGATTC GACTTTGATGATGATGTCAAGAAGAAAATTTGGTGGCAATACAAGGAGTCTATGCGGTAT GATCAACTTCGTGATGTGGTGGCCAAGCGGAAACCTGGCTGGGAGAACTTACAGGAAGCC TTGATCTCCATAGATCCTGCTCGAGCCAGGGAAGATCCTGTTATTGTAAAAAATATCCCT TACTATAAAGCCAAGAAAGCACTTGAAGCAGAAGTCATGAAACTTGATCCTCCACCAAGG CCACAAAATTGGGGTGAACTGGACCTTCCATTGAATGCATCTTCTTGGAGCAAGGAGGAT CTCAAAAATCCTGAAAAGTTCTATGAAATGACTGTTCTTCTAAATGCTCAAAGAGAAATT GCTGATAAAATTTTGGATTCACAGTGGGAGAATAGATGGCGCCAGCAAAGGTTGAATGAG ATGTTGGAGGAGAAGGTACGTCCATACATGCAGAACATTGACAGTGGGATCCTCTCTCAG CCTATTATATTACCATCACAAGATCAGAATCAGAAGAAGACCCGACAACGGAGATGGTGG TTCTTTTGA
PEP GEKATAECVADAIADNRAELVHLPSSINLHAPLPSKDCPTCDGTGVVGCHECKDKLQVRI SADDIMEPPWKAYNHIVHSMKDPSIAAFWLFTLPQVAGGFDFDDDVKKKIWWQYKESMRY DQLRDVVAKRKPGWENLQEALISIDPARAREDPVIVKNIPYYKAKKALEAEVMKLDPPPR PQNWGELDLPLNASSWSKEDLKNPEKFYEMTVLLNAQREIADKILDSQWENRWRQQRLNE MLEEKVRPYMQNIDSGILSQPIILPSQDQNQKKTRQRRWWFF


| Top |