Cherry SNP DataBase

Gene information

Gene Pav_sc0006091.1_g050.1.mk
Chromosome name PAV_r1.0chr8
start 1370451
end 1377080
PAV_r1.0 name Pav_sc0006091.1
start 44824
end 51453
direction -
Annotation NR PREDICTED: uncharacterized protein LOC103336512 isoform X2
Sequence CDS ATGGCTAGAGTTTGCTGGCCATACTTTGATCCTGAGTATGAGAACCTGAGCACAAGAATC AATCCCCCAAGGGTATCTGTAGACAACTCTAGCTGCAGTGACTGTACTCTAGTCAAGGTC GATAGTGTCAACAAACCCGGAATTCTGCTTGAAGTCGTGCAAATCTTGACAGACCTTGAC CTCATAATCACCAAAGCCTACATCTCCTCTGATGGCGGATGGTTCATGGACGTATTTCAT GTCACCGATCAACAAGGAAAAAAACTTTCAGACAGCAAAACCATTGACTACATAGAGAAG GCTTTAGGACCCAAGGGCCATATCACAGATGTACTGAAGGCCTGGCCAGGAAAACGGGTT GGAGTGCACTCTGTTGGTGATCACACAGCCATTGAGCTCATTGGCAGAGACCGGCCAGGC CTCTTATCCGAGATCTCTGCTGTCCTTGCCAATCTTCACTTTAATGTAGTTGCTGCTGAA GTATGGACGCACAATAGAAGAATAGCCTGCGTTGTGTATGTCAACGATAATTCTACATGC CAACCTGTGGATGATCCAAACAGATTATCTACCATGGAAGAGCAGCTCAAGAACATCCTG CGTGGGTGTGAGGATGATGAGAAAGTTGGTCGTACAAGCTTCTCTATGGGGTTCACCCAT GTTGATAGGCGGCTACACCAGATGTTGTTTGCTGATAGGGATTATGAGGGTGATGGACTA GCAAATGAAGTTGATCACTATCCTCCCTGCTTCCAACCGAAGATCACGATTGAGCGTTGT GAAGAAAAGGGATACTCAGTGGTCAGCGTCCGGTGCAAAGACCGCGCAAAGCTCATGTTT GATATTGTATGCACACTCACAGATATGCAATATGTTGTTTTCCATGCCACCATTTCGTCT GATGGACCGTACGCATCACAGGTATATGCATTTGATGCTCATCTGATGGCCTATTCGCAA GTTCTCCAAATTAAGTTTCTCCAGCAGATCATTTTAAGTGGTTGCTTTTCTGATCTAAGG CTAGAGCTATGTGCAAAGGATAGAGTAGGCTTGCTATCTGAAGTAACAAGGATCCTGAGG GAGAATGGGCTGTCAGTAACAAGAGCAGGCGTCACAACTATTGGGGAGCAAGCAATGAAT GTCTTTTATGTTAGAGATTCTTCAGGCAATCCAGTGGACATAAAGACCATCGAAGCACTT CGTAAAGAAATCGGGCACACAACGATGTTCAATGTGAAGAAAGTACCAACAAGTTCTAAG GCACCTGAGACGAAGGGATGGGGCAAGACAAGCTTCTTCTTTGGGAACTTGTTAGAGAGG TTTTTGGCTTGA
PEP MARVCWPYFDPEYENLSTRINPPRVSVDNSSCSDCTLVKVDSVNKPGILLEVVQILTDLD LIITKAYISSDGGWFMDVFHVTDQQGKKLSDSKTIDYIEKALGPKGHITDVLKAWPGKRV GVHSVGDHTAIELIGRDRPGLLSEISAVLANLHFNVVAAEVWTHNRRIACVVYVNDNSTC QPVDDPNRLSTMEEQLKNILRGCEDDEKVGRTSFSMGFTHVDRRLHQMLFADRDYEGDGL ANEVDHYPPCFQPKITIERCEEKGYSVVSVRCKDRAKLMFDIVCTLTDMQYVVFHATISS DGPYASQVYAFDAHLMAYSQVLQIKFLQQIILSGCFSDLRLELCAKDRVGLLSEVTRILR ENGLSVTRAGVTTIGEQAMNVFYVRDSSGNPVDIKTIEALRKEIGHTTMFNVKKVPTSSK APETKGWGKTSFFFGNLLERFLA


| Top |