Cherry SNP DataBase

Gene information

Gene Pav_sc0006279.1_g040.1.mk
Chromosome name PAV_r1.0chr8
start 5004906
end 5015985
PAV_r1.0 name Pav_sc0006279.1
start 13441
end 24520
direction +
Annotation NR
Sequence CDS ATGGTTTTCACAATACCGCCTATCCCCCGTGTTTCTCTACTGGACGGAAAGGGAAGGGCT TTCACCCCGCAAGTTAACTTCTTTCTCACTCTCACAAGCTCGCAAGCTCACAAGCTCACA AGCTCGCAAGCTTCAATCTCTCTCAACTCCGGAGTCTTCATTCACATAAAGGTAGGTTCT GCGAATAAGTAG
PEP MVFTIPPIPRVSLLDGKGRAFTPQVNFFLTLTSSQAHKLTSSQASISLNSGVFIHIKVGS ANK


| Top |