Cherry SNP DataBase

Gene information

Gene Pav_sc0006365.1_g070.1.mk
Chromosome name PAV_r1.0chr6
start 8801165
end 8809570
PAV_r1.0 name Pav_sc0006365.1
start 48733
end 57138
direction +
Annotation NR PREDICTED: peptidylprolyl isomerase domain and WD repeat-containing protein 1
Sequence CDS ATGGGGGAAACTGAGAACGGAAAAACCCTAGCAACAGACGTAGAGGAACCCCAGAACGGA AAGCACGTAGCAACAGACGCGGTGGAGCCTCAGAGCGGCAACGCAAGCTCTGCCGTAGCG GAGAGCGAGGAGGAGCCCCTGGTGGGTCCGGGCCCAGCCCCTCGCTCTCGGCCCAAGCGG CCTCTCCAGTTCGAGCATGCCTACCTCGACGCCCTTCCCTCAGCTCAAATGTATGAGAAA AGTTATATGCACCGTGACGTGGTTACACATGTTGCTGTGTCTTCGGCGGAATTTGTTGTA ACTGGAAGTGTTGATGGGCATTTGAAGTTTTGGAAGAAGAAGGCTATTGGCATTGAGTTT GCAAAGCATTTTAGGTCCCACCTGGGTCCAATTGAAGGCCTAGCTTCATCAACCATGACT TGTTCAGCTATGCAGGTTAGTGTTGATGGTTTGCTTTGCTGTACAATTTCAAATGACCAC TCTGTGAAGATATATGATGTAGTCAATTATGATATGATGGTCATGATTCGAACACGTTTT GTTCCTGGTGCTGTTGAGTGGGTCTACAAACAAGGGGATGTCAAAGCCAGGCTTGCCATC AGTGATAGAAACTCGTCATTTGTACACATTTTTGATGCACGAGCTGGTACAAATGAACCT ATAATCTCTCGAGAGATACACTTGGGCCCAGTGAAAGTTATGAGGTATAATCCTGTATTT GATACAGTGATATCAGCTGATCAACAGGGAATAATTGAGTATTGGAGTCCTGCTACGCTT GAGTTTCCAGAGGATGGGTATGTGCTCTTTGGCATGGTGAAGTTTAGAGTGAAAAGTGAC ACCAGTCTTTTTGAATTCTTGAAATGCAAAACTACTGTTTCTTCTATTGAGATTAGCCCG GATGGTAAGCAGTTTTCAATTACATCGCCTGATCGCAGGATACGTGTGTTTTGGTTTAGC ACGGGTAAATTGCGACGAGTCTATGATGAATCTCTTGAGGTGGTAAATTTACACACTAAT AAAGTTGCCCGAATTCTTGGAAAAGTGGAAAATAATGATAGGTTTTTGAGAATTGCCCTA TATCAAGGTGACAGAAGCAGTAAAAAAGTCAGAAAAATTCCCGCAGCTGCAGCAAATGTG AATGAAAGCAAAGAGCCTTTGACGGATCCCACTCTCATATGTTGTGCTTTCAAGAAGCAT AGAATCTATCTGTTCAGTCAGAGAGAACCAGAGGAGCCTGAAGATGCAACTAAGGGAAGA GATATATTCAATGAAAAGCCTCCTGCTGATGAACTCTTGGCTGCATCAGATATTGGCAAA TCAGTCACAACATCTCTTCCTGACAATGTGATTTTGCATACTACGATGGGTGACGTACAC ATGAAATTGTATCCAGAGGAATGCCCTAAAACTGTGGAGAACTTCACAACACACTGCCGG AATGGCTATTATGATAACCTCATATTTCATCGAGTGATCAAAGGTTTCATGATACAAACA GGAGATCCTTTAGGAGATGGTACTGGTGGGCAATCTATTTGGGGAAGGGAGTTTGAAGAC GAGTTTCACAAAAGTTTACGACATGACAGGCCTTTCACTGTATCGATGGCAAATGCGGGA GAGAACACAAATGGATCTCAATTTTTTATCACCACGGTGGCTACTCCTTGGCTTGACAAC AAGCACACAGTTTTTGGCAGAGTTATCAAGGGAATGGATGTCGTACAGGCTATAGAGAAA GTGAAGACAGACAGGGGAGACAGGCCCCAAGTAGATGTGAAAATTCTAAATGTTACTGTC CCTAAGTCTTAA
PEP MGETENGKTLATDVEEPQNGKHVATDAVEPQSGNASSAVAESEEEPLVGPGPAPRSRPKR PLQFEHAYLDALPSAQMYEKSYMHRDVVTHVAVSSAEFVVTGSVDGHLKFWKKKAIGIEF AKHFRSHLGPIEGLASSTMTCSAMQVSVDGLLCCTISNDHSVKIYDVVNYDMMVMIRTRF VPGAVEWVYKQGDVKARLAISDRNSSFVHIFDARAGTNEPIISREIHLGPVKVMRYNPVF DTVISADQQGIIEYWSPATLEFPEDGYVLFGMVKFRVKSDTSLFEFLKCKTTVSSIEISP DGKQFSITSPDRRIRVFWFSTGKLRRVYDESLEVVNLHTNKVARILGKVENNDRFLRIAL YQGDRSSKKVRKIPAAAANVNESKEPLTDPTLICCAFKKHRIYLFSQREPEEPEDATKGR DIFNEKPPADELLAASDIGKSVTTSLPDNVILHTTMGDVHMKLYPEECPKTVENFTTHCR NGYYDNLIFHRVIKGFMIQTGDPLGDGTGGQSIWGREFEDEFHKSLRHDRPFTVSMANAG ENTNGSQFFITTVATPWLDNKHTVFGRVIKGMDVVQAIEKVKTDRGDRPQVDVKILNVTV PKS


| Top |