Cherry SNP DataBase

Gene information

Gene Pav_sc0006365.1_g080.1.mk
Chromosome name PAV_r1.0chr6
start 8818093
end 8822729
PAV_r1.0 name Pav_sc0006365.1
start 65661
end 70297
direction +
Annotation NR PREDICTED: histidine-containing phosphotransfer protein 1-like
Sequence CDS ATGCCTGGAGCGACTCTGCTCACCCAACAACTCAACAACTTCATCCGCTCCTTGCGAGAG CAGGGAATACTGGACTTCCACTTTGAAGAACTGAAAGAGTTAGAAAGCGACACTCCTTGC TTAGTTGTGGAAGCAATAACCATGTTCCTTCGCGACGCTGACTGTTCTATAGCAGAACTT CTAAGAACTCTGGGTGCACCTCTTATCAACTACTCTAGGGTGACAGAAATTGCCTTCCAG CTCAAAGGAAGTAGCTCAAGTGTTGGTGGTTGCCGGATGGCCCATGCCTGTTGTGAGCTT CGAGATGCAAGTGAAGCATATTCCAAAGAAAGGTCCCTTTCAGGCTTTGACAGGGTCAGA CGCGAGTATCTTGTCTTGCGGGAGAATCTGAATCAAATTCTTCAGATGGAACATGCAATT AGCGCGTTTGAGCCCAGAAGGTGCCGTCAGTAG
PEP MPGATLLTQQLNNFIRSLREQGILDFHFEELKELESDTPCLVVEAITMFLRDADCSIAEL LRTLGAPLINYSRVTEIAFQLKGSSSSVGGCRMAHACCELRDASEAYSKERSLSGFDRVR REYLVLRENLNQILQMEHAISAFEPRRCRQ


| Top |