Cherry SNP DataBase

Gene information

Gene Pav_sc0006558.1_g070.1.mk
Chromosome name PAV_r1.0chr1
start 41592902
end 41601135
PAV_r1.0 name Pav_sc0006558.1
start 24440
end 32673
direction -
Annotation NR PREDICTED: ran-binding protein 10
Sequence CDS ATGAGCAACAACACCAACAGTACCAACGGCCACAGCGATCGAGATCTCGGCCTGTGGTTC CTAGAGCAGTCGCGGCTCGGCTCGGCTCGTGTGCCGACGGACATGGACGAGGACGAGGAG GCTCCTACAGAGCTCAACACCATCAATAGCTCTGGAGGCTTCCTCGTGGTGTCGCCCGAT AAGCTCTCGGCCAAGTACACCAACGTCAACCTTCATGGACACGACGTCGGTGTAGTTCAG GCTAACAAGCCAGCTCCGGTCAAGCGGCTCGTCTACTACTTCGAGATTTATGTCAAGGAT GCTGGGACCAAGGGTCAGATTGCCATTGGATTTACTTCTGAGAGCTTCAAGATGCGGAGG CAGCCCGGGTGGGAGGCAAATAGTTGTGGCTATCATGGGGATGATGGACTACTTTATCGT GGACATGGAAAAGGAGAGGCTTTTGGCCCAACCTACACCTCTGGTGATAGAGTTGGAGGT GGTATCAATTATGCTTCACAGGAGTTCTTTTTCACTAAAAATGGTGCTGTAGTGGGGACA GTGCCCAAGGATATGAAGGGTCCCTTATTTCCTACAATTGCTGTACACAGCCAAAATGAG GAGTATGTGGATTGTGTTGCTCTGCTGGCATACGAACGGCCACAAGAGTCCTCAGTTGGA TATCTGCTTGAAGAGTCACAGCGTGAAGTTGTCGCAGACACAGTTAATGCAATGATCTTG TCTACAAATCCAAACCTGAAAGATTCACAAAGTTGCTTGCATTCATATCTTGAGAGGTTA CTCAGGCAACTCACTGCTTGCTGTTTGGAAAGAAGGTTGTTGAGTGGGGATCAAGGTGAA GCTTTCCATCTGCACAGAGTACTTAACAGTTGTAAGAAGGCTAGATGCTAG
PEP MSNNTNSTNGHSDRDLGLWFLEQSRLGSARVPTDMDEDEEAPTELNTINSSGGFLVVSPD KLSAKYTNVNLHGHDVGVVQANKPAPVKRLVYYFEIYVKDAGTKGQIAIGFTSESFKMRR QPGWEANSCGYHGDDGLLYRGHGKGEAFGPTYTSGDRVGGGINYASQEFFFTKNGAVVGT VPKDMKGPLFPTIAVHSQNEEYVDCVALLAYERPQESSVGYLLEESQREVVADTVNAMIL STNPNLKDSQSCLHSYLERLLRQLTACCLERRLLSGDQGEAFHLHRVLNSCKKARC


| Top |