Cherry SNP DataBase

Gene information

Gene Pav_sc0006673.1_g020.1.mk
Chromosome name PAV_r1.0chr6
start 13756780
end 13759825
PAV_r1.0 name Pav_sc0006673.1
start 8575
end 11620
direction -
Annotation NR PREDICTED: phospho-2-dehydro-3-deoxyheptonate aldolase 2, chloroplastic-like
Sequence CDS ATGGCTCTGACAAACCCAGCAACTCTGTCTTCCAAATCACTCTGCAATACTCACTCTCTT TCCCCTCCTACACCCCAATCTCACCAACCCATTTTCTCTCCATTCCTCACCAAGAGAAAG ACCCTCCACCCAATCTGCGCCGCCGCCGCCGCCGACTCCGGCAAGGCCCCCGTCGTCGCC GAAAAGCCTCCCAAGGCCTCGACTGAGGTGAAGCCAGTTTCCGGCAAATGGAGCGTGGAG AGCTGGAAAACCAAGAAGGCCTTGCAGCTCCCGGAGTACCCAGATCAGAATGAGCTCGAG ACTGTGCTCCAGACCATCGAGTCTTTTCCTCCGATTGTGTTTGCTGGAGAGGCCAGGCAC TTGGAGGAGAAGCTGGCTGAGGCTGCCTTGGGCAATGCTTTTCTTTTGCAAGGTGGGGAT TGTGCTGAGAGTTTCAAGGAGTTCAGTGCCAATAACATCAGGGACACCTTCAGAGTTATG CTTCAGATGGGTGTTGTTCTCATGTTTGGAGGCCAAATGCCTGTTATCAAGGTGGGAAGA ATGGCTGGTCAATTTGCAAAGCCGAGATCGGAGGCATATGAGGTGCAGGATGGAGTGAAG TTGCCAAGTTACAAAGGGGACAATATAAATGGTGATGCTTTTGATGAGAAATCTAGAAAT CCAGATCCTCAGAGGTTGATAAGGGCTTATTGCCAATCTGCGGCTACTTTGAATCTTCTT AGGTCCTTTGCCACCGGAGGGTATGCGGCTATGCAGAGGGTTACACAATGGAATCTTGAT TTTGCTCAGAACAGCGAGCAGGGAGATAGGTACCAGGAACTGGCTAGCCGGGTCGATGAG GCCTTAGGGTTCATGACGGCTGCTGGACTTACAATTGAACACCCCATCATGACAACAACT GATTTCTGGACATCCCATGAGTGTTTGCATCTGCCCTATGAGCAATCACTCACAAGGAAG GATTCTACTTCTGGTTTGTACTATGATTGCTCTGCTCACATGCTTTGGGTCGGGGAGCGT ACCAGGCAACTGGATGGTGCCCACGTAGAGTTCCTAAGAGGACTTGCCAATCCCCTTGGC ATCAAGGTGAGCAACAAAATGGACCCAAAAGAGCTTGTTAACATCATCGAAATCCTGAAC CCTAGTAACAAGCCAGGAAGGATCACAATCATTGCAAGAATGGGTGCTGAGAACATGAGA GTCAAGCTTCCTCATTTGATTAGGGCTGTCCGCCAAGCAGGGCAAATTGTGACCTGGGTC TGTGATCCAATGCACGGAAACACCATAAAGGCACCTTGTGGACTTAAAACACGTCCATTT GATTCTATTCTGGCTGAGGTGCGAGCATTCTTTGATGTGCACGAACAAGAAGGTAGCCAT CCTGGAGGAATTCATTTGGAGATGACTGGCCAGAATGTGACAGAGTGCATTGGAGGGTCT CGAACAGTGACTTTCGATGATCTGAGCTCACGTTACCACACACACTGCGACCCGAGGCTC AATGCTTCTCAGGCTCTTGAGCTATCCTTTATCATTGCAGAACGACTTAGGAAGAGAAGG ATTGGAACTCAACGGTCACTCTCTTTAGGCCTCTAA
PEP MALTNPATLSSKSLCNTHSLSPPTPQSHQPIFSPFLTKRKTLHPICAAAAADSGKAPVVA EKPPKASTEVKPVSGKWSVESWKTKKALQLPEYPDQNELETVLQTIESFPPIVFAGEARH LEEKLAEAALGNAFLLQGGDCAESFKEFSANNIRDTFRVMLQMGVVLMFGGQMPVIKVGR MAGQFAKPRSEAYEVQDGVKLPSYKGDNINGDAFDEKSRNPDPQRLIRAYCQSAATLNLL RSFATGGYAAMQRVTQWNLDFAQNSEQGDRYQELASRVDEALGFMTAAGLTIEHPIMTTT DFWTSHECLHLPYEQSLTRKDSTSGLYYDCSAHMLWVGERTRQLDGAHVEFLRGLANPLG IKVSNKMDPKELVNIIEILNPSNKPGRITIIARMGAENMRVKLPHLIRAVRQAGQIVTWV CDPMHGNTIKAPCGLKTRPFDSILAEVRAFFDVHEQEGSHPGGIHLEMTGQNVTECIGGS RTVTFDDLSSRYHTHCDPRLNASQALELSFIIAERLRKRRIGTQRSLSLGL


| Top |