Cherry SNP DataBase

Gene information

Gene Pav_sc0006769.1_g030.1.mk
Chromosome name PAV_r1.0chr8
start 2163723
end 2166387
PAV_r1.0 name Pav_sc0006769.1
start 10197
end 12861
direction +
Annotation NR
Sequence CDS ATGCCTACTGTTTGGTTTCCATCGGAGGCTCCGAGAATTTCTACAGCACATTCGAGGCCG AGTTGGCAGATGTCATCCCTGTCGTTAAAACCTCCATTGGCGGCACTCGCATCATTGGCC GCCTCTGTGCGGGAAACAAAAACGGCCTTCTTTTGCCTCACACGACCACAGACCAAGGGT TGCAATTCGAGAACTCGTGCGAGGTTGGGGTGTTCTCGAAGCTGA
PEP MPTVWFPSEAPRISTAHSRPSWQMSSLSLKPPLAALASLAASVRETKTAFFCLTRPQTKG CNSRTRARLGCSRS


| Top |