Cherry SNP DataBase

Gene information

Gene Pav_sc0007253.1_g130.1.mk
Chromosome name PAV_r1.0chr4
start 8957325
end 8980027
PAV_r1.0 name Pav_sc0007253.1
start 85884
end 108586
direction -
Annotation NR PREDICTED: nuclear-pore anchor
Sequence CDS ATGCCGCTCTTCGTTTCCGACGAGGACTTCTCCCGCCACGGAAACGACGCCACTTGGGTG GCGGACAAGGCCGACGCGTTCATCCGCGACTTACAGACGGAGCTAGAGACGTTCAGGGCC CAGAACGACGCCGCTTCTATCACGGCCGAGCAGACCTGCTCCCTCCTCGAGCAGAAGTAC CTATCACTCTCCGATGAATTCTCCAAGCTCGAGTCGCAATACGCGCAGCTTCAGTCCTCC CTCGACCACCGCCTCTCCGAGGTCGCCGAACTCCAGTCCCAAAAGCACCAGCTCCATCTC CAATCGATTGGGAAGGATGGGGAGATAGAGAGGTTTAAGACGGAGGTGTCGGAGCTGCAC AAATCAAAGAGGCAGTTGATAGAGTTGGTGGAGCAGAAGGATTTGGAGATTAGTGAAAAG AATGCCACCATCAAGTCTTATATGGACAGGATTGTTTATTCATCAGACAATGCTGCACAA AGGGAGGCCCGTTTAAGTGAAGCTGAGGCAGAATTAGCACGCACCAAGGCTTCATGTACT CGTCTATCACAGGAGAAAGAACTTATTGAGAGGCATAATGTCTGGCTTAATGATGAGTTA ACAGAGAAAGTTGACAGTCTCATTGGGCTACGTAGAACGCATGCTGATGTTGAGGCAGAT TTGTCTTCTAAACTTGCAGATGTTGAGAGACAATTCAATGAATGCTCTAGCTCTTTAAAA TGGAACAAGGAAAGAGTGAGGGAACTGGAAGCAAAGCTAAGATCTCTACAGGAGGAACTA TGCTCATCTAAAGATGCTGCTGCAGCCAATGAAGATCGGTTAAACGCTGAACTTTCAACA TTAAATAAGCTTGTTGAACTATATAAAGAAAGTTCTGAGGAATGGTCCAAGAAGGCCGGA GAGCTTGAGGGTGTGATCAAGGCTCTGGAGACACATTTGAGTCAAGTGGAAAATGATTAC AAAGAGAGACTTGAGAGGGAAGAATCAGCAAGAAATCAATTTCAGAAGGAAGCTGCAGAT CTGAAAGCAAAACTTGAGAAGTGTGAAGCAGAAATCGAAACGAGCAGGAAAGCGAATGAG CTAAATCTTCTTCCACTCAGTAGTTTTACCACGGATGCATGGACGAATTCATTTGAATCT ACTGACATGGTTGAGGTTAATCGTGCGGTTGTCCCAAAGATTCCTGCTGGTGTTTCAGGA ACAGCATTAGCAGCTTCACTTCTACGGGATGGTTGGAGTCTTGCAAAAATGTATGCGAAG TACCAAGAGGCTGTTGATGCCTTTCGTCATGAGCAGTTGGGAAGGAAGGAATCTGAGGCA ATTTTGCAACGGGTTCTATATGAATTAGAGGAGAAAGCAGAAGTCATTTTGGATGAAAGA GTGGAACATGAGAGAATGGTTGAGGCATATTCTATGATCAACCAAAAACTGCAGAATTCA ATTTCTGAACAGGCAAACTTAGAGAAAACCATCCAGGAGTTAAAGGCGGAGATAAGGAGG CATGGGCGTGACTACACATTTGCTCGAAAAGAGATCTCTGATCTCCAGAGAGAGGTGACA ATCCTTCTGAAAGAATGTCGAGATATACAGCTTCGTGGCACATCTTCTGGTCATGATAGT CATGACTACGGTACTGTTGCTGTGGTTGAGATGAATGCTGAATCTGATGCTGAAATAGTC ATATCTGAACATCTTTTGACCTTCAAGGACATAAATGGACTAGTTGAGCAGAATGCACAG CTCAGGAGTCTTGTTCGCAATCTTTCTGACCAGCTTGAAAATAGGGAAATGGAGGTCAAG GAAAAGTTTGAAATGGAGCTCAAGAAACATACTGATGAAGCTGCCTCTAGAGTTGCGGCA GTGTTACAAAGAGCTGAAGAGCAAGGGCACATGATTGAATCCCTTCACTCCTCCGTTGCA ATGTACAAAAGGTTATATGAAGAGGAGCATAAACTTCATTCATCTAGTCCCCGCTTAGCA GAGGCAGCTCCAGAAGAAAGAAGAGCTGACGTTAAGCTTCTCCTTGAGAGTTCCCAGGAA GCTACCAGAAAGGCCCAAGACCAGGCTGTAGAACAAGTGAAATGTCTGGAGGAAGATTTG GCAAAGACCAGGAGTGAGATCATATCATTGCGGTCAGAGCGTGACAAGTTGGCTTTGGAA GCAAATTTTGCTCGAGAAAGACTTGAGAGCTTCATGAAAGAATTTGAGCATCAGAGAAAA GAAACAAATGGTGTTTTAGCAAGGAACGTTGAGTTCTCTCAGTTAATAGTTGACTACCAA CGGAAGCTTCGTGAAAGTTCTGAATCTGTGCAAACTGCTGAGGAGCGTTCTAGGAAGTTC ACTATGGAGGTATCTGTTTTGAAGCATGAAAAAGAGATGTTGGAACATGCTGAGAAGAGA GCTTGTGATGAAGTTCGTAGTTTGTCGGAGAGGGTCTATAGACTTCAGGCTAGTTTAGAC ACTATTCAGAGTGCCGAGCAAATTCGTGAGGAGGCAAGAGCTGCTGAGAGGAGAAGACAA GAAGAGTATACAAAACAAATAGAGAGGGAGTGGGCAGATGTCAAGAAAGATCTACAAGAA GAGCGCAACAATGCCCGCACTCTCACTCTTGACCGTGAGCAGACCATACAAAATGCCATG AGACAAGTTGAAGAAATGGGAAAAGAGTTGTCTAATGCATTGCATGCTGTTGCATCAGCT GAGAGTAGAGCTGCTGTAGCCGAGGCTAAACTGACTGATCTGGAGAAAAAGATAAGATCC TCCGATATTAAGGTTGTGGATATTGATGGTGAAAGTGGATCTTCCTCTTTGACGAGTGAT GAGGCTGTGGTGGCATTGCGTGCTGCAAAGGAAGAGATCGAAAAATTGAAAGAGGAAGTG AAAGCTAATAAGGATCACATGCTACAGTACAAGAGCATAGCTCGGGTAAACGAAGATGCA TTGAGACAGATGGAATTTGCCCATGAAAACTTCAAGATTGAGGTACTTCTGTGTGTCAAC CTTTTGGCTTGTTTGCATTATTATGTCAATGTCAAATAA
PEP MPLFVSDEDFSRHGNDATWVADKADAFIRDLQTELETFRAQNDAASITAEQTCSLLEQKY LSLSDEFSKLESQYAQLQSSLDHRLSEVAELQSQKHQLHLQSIGKDGEIERFKTEVSELH KSKRQLIELVEQKDLEISEKNATIKSYMDRIVYSSDNAAQREARLSEAEAELARTKASCT RLSQEKELIERHNVWLNDELTEKVDSLIGLRRTHADVEADLSSKLADVERQFNECSSSLK WNKERVRELEAKLRSLQEELCSSKDAAAANEDRLNAELSTLNKLVELYKESSEEWSKKAG ELEGVIKALETHLSQVENDYKERLEREESARNQFQKEAADLKAKLEKCEAEIETSRKANE LNLLPLSSFTTDAWTNSFESTDMVEVNRAVVPKIPAGVSGTALAASLLRDGWSLAKMYAK YQEAVDAFRHEQLGRKESEAILQRVLYELEEKAEVILDERVEHERMVEAYSMINQKLQNS ISEQANLEKTIQELKAEIRRHGRDYTFARKEISDLQREVTILLKECRDIQLRGTSSGHDS HDYGTVAVVEMNAESDAEIVISEHLLTFKDINGLVEQNAQLRSLVRNLSDQLENREMEVK EKFEMELKKHTDEAASRVAAVLQRAEEQGHMIESLHSSVAMYKRLYEEEHKLHSSSPRLA EAAPEERRADVKLLLESSQEATRKAQDQAVEQVKCLEEDLAKTRSEIISLRSERDKLALE ANFARERLESFMKEFEHQRKETNGVLARNVEFSQLIVDYQRKLRESSESVQTAEERSRKF TMEVSVLKHEKEMLEHAEKRACDEVRSLSERVYRLQASLDTIQSAEQIREEARAAERRRQ EEYTKQIEREWADVKKDLQEERNNARTLTLDREQTIQNAMRQVEEMGKELSNALHAVASA ESRAAVAEAKLTDLEKKIRSSDIKVVDIDGESGSSSLTSDEAVVALRAAKEEIEKLKEEV KANKDHMLQYKSIARVNEDALRQMEFAHENFKIEVLLCVNLLACLHYYVNVK


| Top |