Cherry SNP DataBase

Gene information

Gene Pav_sc0009370.1_g080.1.mk
Chromosome name PAV_r1.0chr6
start 11306248
end 11307111
PAV_r1.0 name Pav_sc0009370.1
start 15637
end 16500
direction -
Annotation NR PREDICTED: putative ribonuclease H protein At1g65750
Sequence CDS CTGCGCAGCAAAGGAATCCAAGGGGATGTTGGTGTTTGTGGGTTGTGTGGGGCCCGGGAG GAGACACTACATCATGTTCTCTTGGACTGCTCTTTCACAGCTTTAATCTGGCAGAACAGC CCTTTGCAGACTGAATGGCGTGATCATGATACACGGGACCTCAATGGCTGGCTCGAGCAT ATTCTGATGGGTGGGGATCGTCATAAAACTGAGCTTCTTTTTATGCTTATATGGAATCTC TGGAATGAGCGCAACACGGTCGTATGGACAGCAAAGCGTAGAAGCCCTTGTGAAGTTGTT GATGGCGCTGTGCGATTGCTGCAAGAATTCAAAGAGCATCAGCCTACCATGTTGCAGCCG CTCTCACGAGCCCAGGCGAAATGGCAGAAACCCCCTCTTGGAGCCATAAAGATCAATGTT GATGGGGCTCTCCATGTGCAAACTGGTTCCGGAGGAGGGGGGATTATGGCTCGAGACTCT GCAGGATGTTTCGTGGCTGCCCGTGCATGTCGATTCAGCCACGTCTCTTCCCTAGAACAT GCTGAAATTCTTGCTCTCCGTGCAGCCATTCTATTTTCCCATGACCTTGGCCCGGGGCCA AAGATCATTGAGGGTGATGCGCAAGGAGTGATTCAGACTGTCCAAACCGCGCATGAGGAT AGGTCCATTTTAAGTTTTCTGTTTTCAGATTGCAAGTTTTTACTTTCCCAGTTAGAGAAT ACTTCTATTCAGTTTGCTTTTAGAGAGGCTAATCGAGTAGCCCACCGCTTAGCTCGTTTG GCTATTACCTTACCAGGAACATTAACGTGGCTACAGGACCCTCCTGATGCCGTGTGTGAT GTTTTGGTAGAGGATATTTTGTAA
PEP LRSKGIQGDVGVCGLCGAREETLHHVLLDCSFTALIWQNSPLQTEWRDHDTRDLNGWLEH ILMGGDRHKTELLFMLIWNLWNERNTVVWTAKRRSPCEVVDGAVRLLQEFKEHQPTMLQP LSRAQAKWQKPPLGAIKINVDGALHVQTGSGGGGIMARDSAGCFVAARACRFSHVSSLEH AEILALRAAILFSHDLGPGPKIIEGDAQGVIQTVQTAHEDRSILSFLFSDCKFLLSQLEN TSIQFAFREANRVAHRLARLAITLPGTLTWLQDPPDAVCDVLVEDIL


| Top |