Cherry SNP DataBase

Gene information

Gene Pav_sc0010114.1_g020.1.br
Chromosome name PAV_r1.0chr0
start 120770563
end 120771012
PAV_r1.0 name Pav_sc0010114.1
start 445
end 894
direction +
Annotation NR PREDICTED: putative ribonuclease H protein At1g65750
Sequence CDS ATGGGAGGCTCAAACAGGAAAAAGGGGGTGGGGTGGGTGCTCCGAGATGGCATAGGCTGC TTCATAAGTGCGGGAGGCTATGGGGAAATGCGTTGTGTCTCTGCATTAATAGTGGAGGCA GAGGTGATACCAGAAGCTTTAACCCAGTGTTTGGAGTTTGGGTTTGACAAGGTGGGGATG GAATCTGACTCACTTAGTTTGATCAAAATGCTCAATCAGGAGGTTGTTATGGATTTGCAG ATTGAAGGAATTCTATTTGATATTCAGTGCTTGAGTCAACATTTTCACCAAGTGAAGTTT ATGTATGCTCCGAGAAAATGTAACCAAGCTACCCATTTAGTGGAAGCTTATGTTTTTCAT AGTGGTGGCAGGCTTAGCTGGGATATTGTTTGTCCCGAATGGCTGTTTAACTGCGTAGCC CAAGATGTAAACTGTTCTATTCGTATTTAA
PEP MGGSNRKKGVGWVLRDGIGCFISAGGYGEMRCVSALIVEAEVIPEALTQCLEFGFDKVGM ESDSLSLIKMLNQEVVMDLQIEGILFDIQCLSQHFHQVKFMYAPRKCNQATHLVEAYVFH SGGRLSWDIVCPEWLFNCVAQDVNCSIRI


| Top |