Cherry SNP DataBase

Gene information

Gene Pav_sc0010200.1_g030.1.mk
Chromosome name PAV_r1.0chr6
start 13591990
end 13597539
PAV_r1.0 name Pav_sc0010200.1
start 9007
end 14556
direction +
Annotation NR PREDICTED: calmodulin-binding transcription activator 3
Sequence CDS ATGCTTGAAGAGGATCTGCAACACATAGTTCTCGTCCACTACCGGGAAGTTAAGGGAAAT AGGACAAACTTTAACCATACTAAAGGGACTGAAGAAGCTGTTCCTTATTCCCACGAAACT GAACAAATTGCAATCAACTCTGAGATGGACAATTCTGTTTCTTCTAGTTTCAATCCAAAT ACTTTCCAAATGCGTTCCCAAGCTACAGATACAACAAGCTTGAGTAGTGCTCAGGCATCA GAATTCGAAGATGCTGAATCAGCCTATGATCACCAAGCAAGTTCCCGGTTACAACCTTTT CTCGAATTACTACAGCCTAAGGCTGAGAAGATCAATGCTGGATTCTCTGATGCATTCTAT CCAATGTCGTTTTCAAATAATTATCAAGAAAAATTGTCAGCCATTCCTGGGGTAAATTTT GGCTCACTTACTCAAGCATACAAGAGGGAAGATGGTAATGATGCTGGTGTTACCTATGAG CCCACCAAAAATCTTAATTCTTCGTTATGGGAGGCTGCCTTGGAAAACAGTGCTACTGGA TTTCAGTCTTTGTCTTTTCAGCCATCATTTTCAGCAACACATTCTGATACGATGGGGATT ATCTCTAAGCAAGAAAATGGGATGCTTGGGCGCCTTTTCACAGACAGTTTTGAGAAAAAG CAGATGTGTGAGAGTAAACCAAGGGTCCAACAAGGTTGGCAGACTTCGGAAGAAAACTCG TCATGTTCATCCAGCTGGCTTATGGATCGGAACTTGCATTCAAATACAGCAGATGATGTC TCTACCAGCTTCCATGAAGGACTCAATGCTGCTAATTTACTCAATTCTCTAGCGCCTTGC CATATGAATTCTGATAAGACCAATGATTATTCTATACCAAATGACCTTCAAATACAGCCT TCAACCAGTGAGCAAGAATATTATCTAAAGTCCATTTCAAAGAGAAATGAGACCATAGAG GGAAAAGCCAATCACGCTTCTGCTATAAAGCCTTTGTTAGATGGTCCATTCACTGAAGGC TTGAAGAAGCTTGACAGTTTCAACCGATGGATGAGTAGAGAACTTGGAGACGTGGATGAC ACACAAACGCAGTCCAATTCTGAGACCTACTGGGATACTGTTGAAAGTGAGAATGGGGTT GATGAGTCCAGTGTTCCCCTGCAAGTACGCTTGGATAGCTATATGCTGGGGCCTTCTCTT TCCCAAGACCAGCTCTTTAGCATTATTGATTTTTCACCAAACTGGGCATACGAAAACTCT GAAATCAAGGTTCTGATCACGGGAAGATTCTTGAAGAGTCAACAAGCAGAAGCTTGTAAA TGGTCATGTATGTTTGGGGAAGTTGAAGTTCGTGCTGAGGTTATAGCTGATGGTGTTCTT CGTTGTTATACACCCGTCCATAAGGCTGGGAGGGTTCCATTCTATGTGACATGTTCCAAT AGGCTAGCGTGTAGTGAAGTAAGGGAATTTGAATACCGAGTTGGCCAAATTCCAGATTAT GATGCTAAAGATGATAACAGTGGCTGCACAAATGATATACTTAGTATGCGGTTTGGAAAA TTGTTGTCTCTAAGCTCTACCTCTCCAACTTTTGATCCCAACAGTCAGGGAGAGAATTCA GTGTTGATCAATAAAATTGATTCATTGCTGAAAAATGACAATGGTGAGTGGGACAGGATG CTACAGCTTACGTCAGATGAAGACTTTTCCCTGGAGAGAGTAGAGGAGCAGTTGCTTCAT CAGCTACTTAAAGAGAAGTTGCATGTATGGCTCTTACAGAAGCTGGCTGTTGGTGGGAAA GGCCCTAGTGTACTAGACGAGGATGGCCAAGGTGTGTTACATTTTGGAGCAGCTCTTGGC TATGATTGGGTCTTGCTGCCCACAATTACTGCCGGAGTCAGTGTCAATTTTCGTGATGTG AATGGATGGACGGCTCTTCATTGGGCAGCTTTTTGTGGCAGAGAGCGCACAGTTGCTTCC CTCATCTCTCTTGGCGCAGCTCCCGGAGCATTAACAGATCCAAGTACCAAATACCCTACT GGCAGAACACCTGCAGACCTAGCTTCTGCACGGGGCCACAAAGGAATTGCTGGTTATCTT GCAGAATCTGCTTTGAGCGCCCACCTTTCATCTCTTAATTTGGACATCAAGGAAGGCAAT AATGCTGGGATTTCAGGAGCCAATGCAGTACAAACAGTTTCAGAACGAATTGCAACTCCT ATCGGGAATGGGGATTTAACGGATGGGCTTTCCCTGAGGGATTCTTTAACTGCTGTCTGT AATGCCACCCAAGCTGCTGCTCGTATTCATCAAGTGTTCAGGGTAAAATCTTTTCAGAGG AAGCAGTTGAAAGAATATGGTGGCAATGAATTTGGAATTTCAGATGAGCATGCACTGTCA CTCATTGCAGTGAAGTCACATAAGCCAGGGAAACGTGATGAGCATGTTGATGCTGCTGCA ATACGAATTCAAAATAAGTTCCGTAGTTGGAAGGGTAGAAAAGACTATTTGATCATCCGA CAGCGTATTGTCAAAATTCAGGCTCATGTAAGAGGCCACCAGGTGAGGAAAAACTACAGA AAGATAGTCTGGTCCGTAGGAATTGTAGAGAAGATTATTTTGCGTTGGAGACGAAAAGGA AGTGGATTGCGTGGGTTCAAGTCAGAGCCACTTATAGAGGGCCCCAGCATACAAGTTTCA TCCTCGAAGGATGATGATTATGATTTACTGAAAGAAGGAAGGAAGCAAACTGAGGAAAGG TTGCAAAAGGCCCTTGCTAGGGTGAAGTCCATGGTTCAATATCCTGAGGCAAGAGATCAA TACCGTCGGCTGCTTAATGTTGTTACTGAGATAAAGGAAACCAAGGTGGTATGTGATAGT GCTGTGAATAGTTCAGAAGGGAGAGCTGATATGGACGATGATCTCATAGATTTTGCAGAA TTGTTGGATGAAGACATTTTCATGCCTACAGCAGCTCCATAG
PEP MLEEDLQHIVLVHYREVKGNRTNFNHTKGTEEAVPYSHETEQIAINSEMDNSVSSSFNPN TFQMRSQATDTTSLSSAQASEFEDAESAYDHQASSRLQPFLELLQPKAEKINAGFSDAFY PMSFSNNYQEKLSAIPGVNFGSLTQAYKREDGNDAGVTYEPTKNLNSSLWEAALENSATG FQSLSFQPSFSATHSDTMGIISKQENGMLGRLFTDSFEKKQMCESKPRVQQGWQTSEENS SCSSSWLMDRNLHSNTADDVSTSFHEGLNAANLLNSLAPCHMNSDKTNDYSIPNDLQIQP STSEQEYYLKSISKRNETIEGKANHASAIKPLLDGPFTEGLKKLDSFNRWMSRELGDVDD TQTQSNSETYWDTVESENGVDESSVPLQVRLDSYMLGPSLSQDQLFSIIDFSPNWAYENS EIKVLITGRFLKSQQAEACKWSCMFGEVEVRAEVIADGVLRCYTPVHKAGRVPFYVTCSN RLACSEVREFEYRVGQIPDYDAKDDNSGCTNDILSMRFGKLLSLSSTSPTFDPNSQGENS VLINKIDSLLKNDNGEWDRMLQLTSDEDFSLERVEEQLLHQLLKEKLHVWLLQKLAVGGK GPSVLDEDGQGVLHFGAALGYDWVLLPTITAGVSVNFRDVNGWTALHWAAFCGRERTVAS LISLGAAPGALTDPSTKYPTGRTPADLASARGHKGIAGYLAESALSAHLSSLNLDIKEGN NAGISGANAVQTVSERIATPIGNGDLTDGLSLRDSLTAVCNATQAAARIHQVFRVKSFQR KQLKEYGGNEFGISDEHALSLIAVKSHKPGKRDEHVDAAAIRIQNKFRSWKGRKDYLIIR QRIVKIQAHVRGHQVRKNYRKIVWSVGIVEKIILRWRRKGSGLRGFKSEPLIEGPSIQVS SSKDDDYDLLKEGRKQTEERLQKALARVKSMVQYPEARDQYRRLLNVVTEIKETKVVCDS AVNSSEGRADMDDDLIDFAELLDEDIFMPTAAP


| Top |